KEGG   Lactobacillus plantarum WCFS1: lp_0548Help
Entry
lp_0548           CDS       T00115                                 

Gene name
hsp33
Definition
(RefSeq) heat shock protein HSP33
  KO
K04083  molecular chaperone Hsp33
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lpl03110]
    lp_0548 (hsp33)
Chaperones and folding catalysts [BR:lpl03110]
 Heat shock proteins
  HSP33
   lp_0548 (hsp33)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-GeneID: 1061902
NCBI-ProteinID: YP_004888550
UniProt: Q88Z30
Position
498768..499655
Genome map
AA seq 295 aa AA seqDB search
MADYLVKSVAGNEMFRAYAVSATGVVAEAQRRHDTWSAASAALGRSLVGTLLLASSVLKG
EEQMTVKINGNGPVGGIVVDGNAKGTVKGYLQHPHVHLPLNDKHKIDVKAAVGTDGFLSV
TKDQGVGDPFTGTVALVSGELGEDFTYYLAQSEQIPSAVGLSVFVNDDNSIGVAGGFLVQ
VLPNATDEAISSLENKLKDMPLVSQLMRDGKSPEDILDLLFDGDVKVLDKMPVKFECDCS
KERFAEALMALPKHEVQAMIDEDHGATAVCHFCGDQYQFSERELEAVLSRSKGDA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcagattatttagtaaaaagcgtcgcgggtaatgagatgtttcgagcgtacgcagtt
agcgcaacgggcgtggttgctgaagcccaacgccgacatgatacctggagtgcagcatca
gcagcgttaggccgcagcttggttggtacgttattattagcatcatcggttttaaagggt
gaagaacaaatgaccgttaaaatcaacgggaacggtcctgttggtggtatcgttgttgat
ggcaatgctaaaggtacggtcaaggggtatttacagcacccccatgtgcacttgcctttg
aatgataagcataagatcgatgtgaaggcggctgttggaactgatggctttttatctgtg
actaaggatcagggggttggggatccattcaccggaacggttgcgttagtttctggtgaa
ttaggcgaagactttacgtattacttagcacagtccgaacagattccatcagctgttggc
ttgtcggtgtttgtaaatgacgacaattcgattggagttgccggtggctttttggtgcaa
gtattgccaaatgcgacggatgaagccatcagctcgctagaaaacaagctcaaagacatg
ccattagtctcccaattgatgcgtgatggtaagtcaccagaagatattttggatttatta
tttgatggtgacgttaaggtattagataaaatgccagttaagtttgaatgcgattgttct
aaagaacgatttgccgaagcactaatggctttgcccaagcatgaggttcaagcaatgatt
gatgaagatcatggtgccacggcagtttgtcatttttgtggggaccagtatcagttcagt
gaacgcgaactagaagcagtgctctcacggtccaagggtgacgcttaa

DBGET integrated database retrieval system