KEGG   Lactobacillus plantarum WCFS1: lp_0551Help
Entry
lp_0551           CDS       T00115                                 

Gene name
dtpT
Definition
(RefSeq) di-/tripeptide transport protein
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    lp_0551 (dtpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-GeneID: 1064224
NCBI-ProteinID: YP_004888553
UniProt: F9UL24
Position
508813..510285
Genome map
AA seq 490 aa AA seqDB search
MDKEQKLDRSFFGQPRGLRTLFFTEMWERFSYYGMRALLIYYMYYSVAKGGLGFDQVTAA
SIMSIYSALVYVSSVLGGFLSDRVWGSRKTVFIGGVFIMLGHIVLSTPFGVGALFVSIAL
IVIGTGLLKPNVSDMVGQLYTVEDTRRDAGFSIFVFGINLGSLVAPALVGRIGLNVNFHL
GFSLAAIGMFFGLLQYYFDGKKNLSSASLYPTDPLEPGDLKKIMRWTILGIVGIGLILLL
MQLMNALTLANVISLISTLVILTPIVYFILMLTSDKTNATERSRVRAYIPLFIAAALFWA
IEEQGSSVLALFAANRVNLDLGFTHLAASDFQMLNPLFIMIYTTPFVWLWTKWGKKQPSS
PTKFAIGLLFAGASYLVMAVPGALFGTAGKVSPWWLVASWAVVEIAEMLISPIGLSVTTK
LAPKAFASQMMSMWFLTDSVGSALNAQIVRFYSTQTEVPYFAITGIVSVVLGIILFMMVP
MIKRSMQGIR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttggataaggaacaaaagctggatcggtcgttctttggccaaccccgtggcttacggacg
ttgttcttcactgaaatgtgggaacgattcagttactacgggatgcgtgcgctactgatc
tattacatgtactacagtgtcgctaaaggtggtcttggatttgaccaagtcaccgcagca
tccattatgtcaatctattcggcattagtttacgtttctagtgtcctcggtggctttcta
agtgaccgtgtctggggtagccgtaagaccgtctttattggtggggtcttcatcatgtta
ggccacatcgttttatcaacgccatttggagttggtgcactatttgtttcaatcgcactt
attgtcattgggactgggttattaaagccaaacgtctctgacatggttggtcaattgtat
acagtggaagatacacgtcgggatgcaggttttagtattttcgtcttcgggattaactta
ggttcattggttgcaccagccttagttggtcggatcggcttaaatgttaacttccactta
ggcttctccttagctgcgattgggatgttctttggtctattgcaatactactttgatggt
aagaagaatttaagttctgctagcctctatccaactgatccattagaacccggtgatttg
aaaaaaatcatgcggtggacaatcttaggaatcgttgggattgggttgattctactatta
atgcaattaatgaatgctcttacgttagcaaatgttattagtttaattagtacgcttgtt
atcttgactccaatcgtttactttattttgatgttaacgtctgacaagactaatgcaaca
gaacgttcacgtgttcgggcttatatcccattgtttattgccgctgctttattctgggca
attgaagaacagggttcgtccgtacttgcgttatttgcagctaatcgggttaatttggat
cttggttttacccatctagctgcttctgatttccaaatgctaaacccattgttcatcatg
atttatacaacaccattcgtgtggttgtggactaagtggggtaaaaaacaacctagttca
ccaactaaatttgcgattgggttgctattcgctggggcttcttacctagtgatggctgta
cctggagcactctttggaactgcagggaaggttagtccatggtggttagttgccagttgg
gcagtcgttgaaattgctgaaatgttgatttcaccaattggtttatcagttaccaccaag
cttgcaccaaaggcttttgcttctcagatgatgagtatgtggttcctaactgattcggtt
ggtagtgcgcttaatgcacagattgtccgtttctactcgacgcaaaccgaagtgccatat
tttgcgattaccgggattgttagtgtcgttttagggattatcctctttatgatggtgcca
atgattaaacggtcgatgcaaggcattcgctaa

DBGET integrated database retrieval system