KEGG   Lactobacillus plantarum WCFS1: lp_0558Help
Entry
lp_0558           CDS       T00115                                 

Definition
(RefSeq) di-and tricarboxylate transporter
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CitMHS
Motif
Other DBs
NCBI-GeneID: 1064227
NCBI-ProteinID: YP_004888559
UniProt: F9UL30
Position
complement(514300..515406)
Genome map
AA seq 368 aa AA seqDB search
MVTVVRRTLHDKIFIIALICAGLSLFIGTPQLTAINWATIGTLFALMISVQLLRAMHLLD
TLRDWLLVKSHDTRQMCQLFILLAFGGSMILTNDVAILTLIPIFLTLARRQHLAIAYPTT
LIIMAANLGSAFTPIGNPQNLFLVTFYHVNLFTFFKLSTPLMLASLALLVALSRRLPRLP
LTVTPTKSTPISRSQIGLAGGLLSFIMLGIFNLVPISLVIIGTIVVGLMINRRVFQYVDY
ALLLTFICFFIFVSAISHNPAITHWLNQLTQTAPSVYITGLITSQVISNVPAAILLANFT
PHLSALFLGVNIGGLGSLVASLANLLALKQLLPFNDEQPLHHFLIVFTALNGLGLFILGL
GGWFYLHL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtgacagtcgttcgtcgcacacttcacgataaaatctttattattgcattaatttgt
gctggtttaagtttgttcatcgggacaccccaactgacggcaattaattgggctacgatt
ggcaccttatttgcactcatgatcagtgttcaattacttcgcgcgatgcatttgcttgat
actttaagggactggctcttagttaaatcacacgatacccgtcaaatgtgtcaattattc
atcttactggcctttggtggctcaatgattttaactaacgacgttgcgatcctaacgtta
attccaatctttctcacactcgcccggcggcagcacctggccattgcctacccaacgact
ttaattatcatggcagccaatcttggtagcgcgtttacgcccattggcaatccccaaaat
ttatttttggtcacgttctatcacgttaatctattcacgttttttaaattgtcgaccccg
ttaatgcttgctagtctagctttattagttgccttaagccggcggttacctcggttgccg
ctaactgtaacaccaaccaaatctacgcccatttctcgcagtcaaatcgggcttgcgggc
ggcctgctcagtttcattatgcttggcatttttaatttggtgcccatttcactagttatt
atcggaacgattgtcgtaggcctcatgattaaccgacgcgtctttcagtacgttgattac
gcactactcttaacctttatctgcttcttcatcttcgttagcgccatcagtcataatccc
gcaataacgcattggctcaaccaattaactcagacagcccccagtgtctatatcactgga
ctaattactagccaagtcatcagcaatgttccagccgccatcttactagcgaatttcacg
ccccatttatcagcgctatttttaggcgtcaacatcggcggtctggggtcattggtggcc
tcactagcaaatctgcttgccttaaaacaattgttgcccttcaatgatgaacaaccactc
caccattttttgatcgtgtttacggccctcaatggacttggcctgttcattttaggcctt
ggtggctggttctatttacacctataa

DBGET integrated database retrieval system