KEGG   Lactobacillus plantarum WCFS1: lp_0559Help
Entry
lp_0559           CDS       T00115                                 

Gene name
pnuC2
Definition
(RefSeq) ribosyl nicotinamide transporter, PnuC-like
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMN_transporter DUF3593
Motif
Other DBs
NCBI-GeneID: 1064228
NCBI-ProteinID: YP_004888560
UniProt: F9UL31
Position
complement(515599..516420)
Genome map
AA seq 273 aa AA seqDB search
MNQNNHFRLTLSTLLQQCQQDITSLPTAMRAVFSWQRGLNELKTLRRTTKLMMSTMLIVT
IIGFILGRDYSLHGWIGLLTGITVVINLILVDQGRLTNYSWGIIACAAWLTTAITNRLIG
DIASQSFYLIMQFVGITVWHRKMAAQPDASELTGRKLSKLAGCAWFALAVLVYAIVLHFS
KQLNGNQIYLDATLLPLGIVGSVLMVNGYRSQWVAWITLDVINVIIWFNQLKGFSPAAAS
MLALQLVMLANALYGAYLWFFGQNTQQDKLDTH
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaacaaccatttccgactcaccttatcaaccctgctgcaacaatgccagcaa
gacatcactagtctgcccacggccatgcgcgccgtcttcagctggcaacggggacttaat
gaattaaagacgcttcgccgcaccactaagttgatgatgagcacgatgctaatcgtgacc
atcattggttttattctgggccgcgattacagcctacatggctggattggcctattgacc
gggattacggtcgtgattaacttaattctggttgatcaagggcgactgacgaactatagc
tggggcattattgcttgtgcggcttggctgactacggccatcaccaatcggctgattggt
gacattgcgtcgcaatcattttaccttatcatgcaatttgtcggcatcaccgtctggcat
cgtaaaatggcagcgcaacccgatgccagcgaactgactggtcgtaaattgagcaaatta
gccggttgtgcctggttcgcgttagccgtactcgtctacgccattgtcttacactttagt
aaacaacttaacggtaaccaaatctacctggacgcgaccctgttaccacttgggattgtc
ggtagtgtcctcatggtcaacggttatcgttcccaatgggttgcgtggatcacactcgac
gtgattaacgttattatctggttcaaccaattaaaaggcttcagtcctgcagccgcctca
atgttagcattgcaactagtgatgctcgctaacgcgttatatggtgcctacttgtggttc
ttcggtcaaaacactcagcaagataaactagatacacattaa

DBGET integrated database retrieval system