KEGG   Lactobacillus plantarum WCFS1: lp_0570Help
Entry
lp_0570           CDS       T00115                                 

Definition
(RefSeq) SprT family metallopeptidase
  KO
K03095  SprT-like protein
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    lp_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SprT-like Zn_ribbon_SprT Zn-ribbon_8 OrfB_Zn_ribbon TF_Zn_Ribbon DUF1922
Motif
Other DBs
NCBI-GeneID: 1064239
NCBI-ProteinID: YP_004888570
UniProt: Q88Z10
Position
528944..529390
Genome map
AA seq 148 aa AA seqDB search
MTDLELQQLVATISMHDFHRPFQHRAYFNARLRTTGGRYQLASHDIDINPKMLTDFDEAT
LIGVIKHELCHYHLHLTKRGYRHRDADFKRLLAQVGGSRYAPAPKQATARPYRYIYECQR
CGRRYYRKRRMDTRRYTCGRCQGPIKLV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttagagttacagcagctcgttgcgaccatttccatgcatgattttcaccgt
ccgttccagcaccgcgcttattttaatgctcggttacgaacgacgggtggtcgttatcag
ttggcctcgcatgatattgatatcaatccgaagatgctgactgattttgatgaggccacc
ttgattggcgtcatcaagcatgaattgtgccattatcatttacatttgactaagcgggga
tatcggcatcgtgatgcagactttaaacgattactcgcgcaagtgggtggctcgcgctat
gcaccagcgccgaagcaggcgacggcccggccgtatcggtatatttatgaatgccaacgg
tgtggccggcggtattaccgcaagcgccgcatggacactcgccgctatacgtgtggtcgt
tgtcaggggccaattaaattagtctga

DBGET integrated database retrieval system