KEGG   Lactobacillus plantarum WCFS1: lp_0572Help
Entry
lp_0572           CDS       T00115                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00260  Glycine, serine and threonine metabolism
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01120  Microbial metabolism in diverse environments
lpl01230  Biosynthesis of amino acids
Module
lpl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp_0572 (thrB)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     lp_0572 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 1064240
NCBI-ProteinID: YP_004888572
UniProt: Q88Z08
Position
530751..531626
Genome map
AA seq 291 aa AA seqDB search
MLTISVPATSANLGPGFDSIGLALDMQLTLQVLQPSDHWQIDHPFGADVPTDERNLIIKT
ALHLVPDLQPQHLQMASKIPLARGLGSSSTAIVAGLVLANELTGATRSSAELLEVATQLE
GHPDNVAPALLGGLVVATNTDGRVRAVKLPLPMLFASVYVPNEPLLTTASRQALPTELAY
HQAVTGSSVANTLVAALATQNWDVALPLLEQDQFHEQYRAKLVPALQTVRDHAHALGLTG
TYLSGAGPTVITLGDYGQLATLQAQLSQDTTLTGQLFLLPMDATGVKVQKS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgatttcggttccggcgacttccgctaatcttggtcccggttttgattcaatc
ggtctggcgctggacatgcaactaacgctacaagtgttgcaacctagtgaccattggcag
attgaccatccctttggggcggatgtgccgacggatgaacgcaacttaattattaaaacg
gcgttgcatttggtaccagatttacaaccacagcatttacagatggcttcaaaaatcccg
ttagcgcgcggattgggtagtagctcgacggccatcgtagccggcttagtgctggcaaac
gaattgaccggcgcaacgcgctcttctgctgagctactggaagttgccactcaactggag
ggtcatccagataacgttgcaccagccctattaggaggcttggttgtggcgacgaacact
gatggacgcgtccgtgcggtgaagttaccgttaccgatgctttttgcaagtgtctacgtg
cctaacgaaccgctattgacgaccgccagtcgccaagccttgccaactgaattggcgtac
caccaagccgttactggtagtagtgtggcaaatacgttagtggctgctctagcaactcaa
aattgggacgtggcgttaccgctgctagaacaggaccagttccatgaacagtatcgggct
aagttagtgccggcactacaaacggttagagaccatgcccatgctctgggattaacgggg
acttatttgagtggtgctgggccgacggtgattactttgggtgattacggtcaactcgct
acgttgcaggcacaattgagccaagatacaacactcaccggccaattattcttattgcca
atggatgcaactggtgtaaaagtacaaaaatcttaa

DBGET integrated database retrieval system