KEGG   Lactobacillus plantarum WCFS1: lp_0575Help
Entry
lp_0575           CDS       T00115                                 

Gene name
pts9AB
Definition
(RefSeq) PTS system, mannose-specific EIIAB component
  KO
K02793  PTS system, mannose-specific IIA component [EC:2.7.1.191]
K02794  PTS system, mannose-specific IIB component [EC:2.7.1.191]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00051  Fructose and mannose metabolism
lpl00520  Amino sugar and nucleotide sugar metabolism
lpl01100  Metabolic pathways
lpl02060  Phosphotransferase system (PTS)
Module
lpl_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    lp_0575 (pts9AB)
   00520 Amino sugar and nucleotide sugar metabolism
    lp_0575 (pts9AB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    lp_0575 (pts9AB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpl02000]
    lp_0575 (pts9AB)
Enzymes [BR:lpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.191  protein-Npi-phosphohistidine---D-mannose phosphotransferase
     lp_0575 (pts9AB)
Transporters [BR:lpl02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    lp_0575 (pts9AB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb EIIA-man
Motif
Other DBs
NCBI-GeneID: 1061523
NCBI-ProteinID: YP_004888574
UniProt: F9UL45
Position
533143..534117
Genome map
AA seq 324 aa AA seqDB search
MVSIIIASHGEFAKGIYQSGSMIFGEQENVQAVTLMPSEGPDDIKAKLEKAIASFDDQEQ
VLFLVDLWGGTPFNQVNGLFEAHKDKWAIVAGLNLPMLIEAYASRLSMDSAHEIATHIIE
TAKDGVKVRPEALAPKEEKAAAAATTNNNAGRPGKLEYGLARIDSRLLHGQVATAWSKTV
NPTRIIVVSDSVAKDDLRSNMIKQAAPAGVHAHVIPIDQMIKIAKDDKHFGGQKALVLFE
TPQDALRAIEGGVPIKTLNIGSMAHSVGKVQPNKVLAFDQDDIDTYKKLEQDGVEFDVRK
VPSDSKDNMDNILKKAQNMLNEQK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcattatcattgctagtcacggcgaattcgctaaaggcatctatcaatctgga
tcaatgattttcggcgaacaagaaaacgttcaagccgttacgttgatgcctagcgaaggc
cctgacgacatcaaggctaagttggaaaaagccattgcttcattcgacgatcaagagcaa
gtcttattcttagtcgacctttggggcggtacaccattcaatcaagttaacggcttgttt
gaagcacacaaggacaaatgggcaatcgttgccggtttgaacttgccaatgttaattgaa
gcgtatgcttcacgactttcaatggattcggcacacgaaattgccacgcatatcattgaa
actgctaaggatggcgtaaaggttcgtcctgaagcattagcacctaaggaagaaaaggct
gctgccgctgcaacgaccaacaataacgctggccggccagggaagttggaatatgggtta
gcacggattgactcgcgactcttgcatggacaagttgctactgcttggagtaagacagtt
aacccaactcggatcattgttgtttccgatagtgttgctaaggatgatttacgttcaaac
atgattaagcaagctgctccagcaggcgtacatgctcatgttattccaattgatcaaatg
attaagattgctaaagacgacaagcactttggtggtcaaaaggcgttggtcttattcgaa
acgccacaagatgcattacgtgcaatcgagggtggcgtgccaattaagaccttgaacatt
ggttcaatggcgcactcagttggtaaagttcaaccaaacaaagttttggcttttgatcaa
gatgatattgatacttacaagaagttggaacaagacggcgtcgaatttgatgttcgtaaa
gttccttcagatagtaaggataatatggataatattcttaaaaaggctcaaaacatgtta
aatgaacaaaagtag

DBGET integrated database retrieval system