KEGG   Lactobacillus plantarum WCFS1: lp_0577Help
Entry
lp_0577           CDS       T00115                                 

Gene name
pts9D
Definition
(RefSeq) PTS system, mannose-specific EIID component
  KO
K02796  PTS system, mannose-specific IID component
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00051  Fructose and mannose metabolism
lpl00520  Amino sugar and nucleotide sugar metabolism
lpl01100  Metabolic pathways
lpl02060  Phosphotransferase system (PTS)
Module
lpl_M00276  PTS system, mannose-specific II component
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    lp_0577 (pts9D)
   00520 Amino sugar and nucleotide sugar metabolism
    lp_0577 (pts9D)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    lp_0577 (pts9D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lpl02000]
    lp_0577 (pts9D)
Transporters [BR:lpl02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Mannose-specific II component [MD:M00276]
    lp_0577 (pts9D)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIID-AGA
Motif
Other DBs
NCBI-GeneID: 1061529
NCBI-ProteinID: YP_004888576
UniProt: F9UL47
Position
534979..535896
Genome map
AA seq 305 aa AA seqDB search
MADNKVQITKSDRIKVWMRSNFLQGSWNYERMQNGGWAFTLIPVLKKLYTTKEDRAAALK
RHLEFFNTHPYVASPIIGVTMALEEERANGAPIDDVTIQGVKVGMMGPLAGVGDPVFWFT
LKPIIGALAASLALGGSIMGPILYFVVWNVLRLGFMWYTQEFGYKAGSKITEDLSGGILQ
DITKGASILGMFILPALIERWVVVDFSPVKVSRIKQSAGAYIDWDKLPKGAAGIKEALTQ
QAAGRSLDKYKVTTLQDNLNQLIPGLAALLITFLSMWLLKKKVSPIIIIFGLFAFGVVMH
VLGVM
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctgataataaagtacaaattactaaaagtgatcgtattaaggtttggatgcgttct
aacttccttcaaggttcatggaactacgaacgtatgcaaaatggtggctgggcatttact
ttaatcccagtacttaaaaagttatatacaactaaagaagaccgtgccgcagctttaaag
cgtcatttggaattctttaacactcatccatacgttgcctcaccaatcattggtgtcacg
atggcgttggaagaagaacgtgccaatggtgctccaattgatgatgttacgattcaaggg
gttaaagttggtatgatgggtcctttagctggtgttggtgatccagtgttctggttcacg
ttgaagccaattattggtgccttagctgcttctcttgctttgggcggtagtatcatgggt
ccaatcctatacttcgttgtatggaacgtacttcgtttaggattcatgtggtacacacag
gaattcgggtacaaagctggttctaagattactgaagatttatctggtggtattttacaa
gacatcactaaaggtgcatcaattctaggtatgttcatcttacctgctttgattgaacgg
tgggttgttgttgatttcagtccagttaaagtttcacgaatcaagcaaagtgccggtgct
tatattgattgggataaattaccaaagggcgctgctggtatcaaggaagccttaacgcaa
caagctgctggtcgttcgctcgataagtataaagttacgactttacaagataacttaaat
caattaattccaggattagctgccttattaatcaccttcttgtcaatgtggttactaaag
aagaaagtttcaccaattattatcatcttcggcctcttcgcctttggtgttgttatgcat
gttcttggtgtaatgtaa

DBGET integrated database retrieval system