KEGG   Lactobacillus plantarum WCFS1: lp_0579Help
Entry
lp_0579           CDS       T00115                                 

Gene name
panD
Definition
(RefSeq) aspartate 1-decarboxylase
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00410  beta-Alanine metabolism
lpl00770  Pantothenate and CoA biosynthesis
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lp_0579 (panD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    lp_0579 (panD)
Enzymes [BR:lpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     lp_0579 (panD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_decarbox
Motif
Other DBs
NCBI-GeneID: 1061538
NCBI-ProteinID: YP_004888578
UniProt: Q88Z02
Position
551916..552308
Genome map
AA seq 130 aa AA seqDB search
MLIDMLKGKIHRATVTQADLEYVGSITIDETLMEASGILEYEKVQIADVNNGARFETYVI
AGPRDSGVICLNGATARCASVGDKVIIMNYAQFEPEEAKHAKPYVVLVDDENRLTKRVRY
EKHGLLAEEL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgatatgttaaaaggtaagattcaccgggcaaccgttacacaggccgatttg
gaatatgttggtagtattactattgatgaaacattgatggaagcaagtggaatcttggaa
tacgaaaaagttcaaattgcggatgtaaataatggcgcgcggtttgaaacttatgtgatt
gcggggccaagggactcaggcgtgatttgcttgaacggtgctactgctcgatgtgcatca
gttggcgataaggttattattatgaattatgcgcaatttgagccagaagaggccaagcat
gcaaagccgtatgttgtacttgtcgacgatgaaaatagattgacgaagcgagtacgttat
gaaaagcatggattattagcagaagaactatga

DBGET integrated database retrieval system