KEGG   Lactobacillus plantarum WCFS1: lp_0582Help
Entry
lp_0582           CDS       T00115                                 

Gene name
npsC
Definition
(RefSeq) 4'-phosphopantetheinyl transferase
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS MecA S-antigen
Motif
Other DBs
NCBI-GeneID: 1061542
NCBI-ProteinID: YP_004888581
UniProt: F9UL52
Position
555704..556348
Genome map
AA seq 214 aa AA seqDB search
MKQLLYYLNNQSMYSKLEKFVRAFAPERYQYAMSFYRPQDQYNALVAYTLLAILCRQPRI
ELVRGANDKPFFKSNQDMELSITHNSKFVAVAVSDKPIGIDGEPWQTIDASIIKQVYSEN
EQRELVNFSELDTVFWTAKEAVSKLKNEDFYSIPKTNYYLHHGLLKDQNDKTVNYNVFDL
LEGVITVATEDVNICNFERLHNDELIRFINRFHC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaattattgtattacttgaataatcagagcatgtattcaaaattagaaaaattt
gttagggcatttgctcctgagcgttatcagtatgctatgagtttttatcgaccacaagat
caatataatgctttagttgcatataccttgttagcaatactgtgccgtcagccacggatt
gaacttgttagaggagctaatgataagcctttttttaaatctaatcaggatatggaacta
tcgattactcataatagcaagtttgttgctgtggcagtttctgacaagccaattggtata
gatggggagccctggcaaacaattgatgcttctatcattaagcaagtgtattctgagaat
gagcagcgagaacttgtaaatttttctgagttggatacagtgttttggactgctaaagag
gctgtgagtaagctcaaaaatgaagacttttactctattccaaaaactaattattatttg
catcatggtttattgaaggatcagaatgataaaactgtgaattataacgtctttgattta
ttagaaggtgttataactgttgcaactgaagatgtaaatatttgtaattttgagagactt
cataatgatgaactgatacgttttattaaccgatttcattgttaa

DBGET integrated database retrieval system