KEGG   Lactobacillus plantarum WCFS1: lp_0584
Entry
lp_0584           CDS       T00115                                 

Name
(RefSeq) transport protein, major facilitator superfamily (MFS)
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB
Motif
Pfam: MFS_1 RecG_wedge
Other DBs
NCBI-GeneID: 1061537
NCBI-ProteinID: YP_004888583
UniProt: F9UL54
Position
556941..558182
AA seq 413 aa
MQEYMCNRGYQTLINVAVLSGIGDGLYNIVFVIYAGSLSFSTLAVSLASMATLVPSLLSM
LTGYFADQSRHKVRAILVTRNLQFVLFLILAFLITLPRNIWLFFLLLSINIVSDTLGTYG
NGLALPLLRHLLPENKLKQSMGFMVAMTLMAQVVFQGIGSVIIVMLHHNYMVVGLINALT
FLLSALLVKYRFGVLCVAEPQMVERKQVSMIRSLGLTLRYLYRNNFLFSVIILTFFINVF
GASMSGLINVTLLSVKTMWLVNYGISVAIMNMMISIGMITGSLVTNGIVRKLPLMYLFAI
SLSFSGLCGISFIWHESAYLSIVLLFVMGYFIGKINPRISAIVLQSIPEKRLAAVDGLLN
MVSMLGAPVGQLLFLGIANVVGIAYSWFAFSIGCFFLIVIIVLKFIKMDEPMF
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcaagaatatatgtgtaaccgtggttatcagacattaattaatgttgctgttttaagt
gggataggagacggactatataatattgtttttgttatatatgcaggctcattatcattt
agtacgttagctgtatcattggcatctatggcaacattggtaccatcattactatctatg
cttacagggtactttgctgatcagtctagacataaagtcagagcgatactcgttacgaga
aacttacaatttgttctgttcttaattttggcttttttaattactttaccgagaaatatt
tggctgttttttttgctattatcaattaatattgtttcagacacgcttggaacatatggt
aatggcctagcgctgccgttattacgtcatcttttgcctgaaaacaagcttaagcagtca
atgggatttatggtggcaatgacattaatggcacaagtcgttttccaagggattgggtct
gtaataattgttatgttgcatcataattatatggttgtcggattgattaatgcactaacc
ttcctgttatccgcattacttgttaagtatcgttttggagtactgtgtgtggcagaaccg
caaatggtagagcggaagcaggtttctatgataaggagtctaggactgaccttacggtat
ctgtatcgtaataattttttgttcagtgtgatcattttgacttttttcattaatgtattt
ggagcttcaatgtctggattaattaatgtaaccttattatcggttaaaacaatgtggctg
gttaattacggaatcagtgttgctattatgaatatgatgatttcaattgggatgataact
ggctctcttgttacaaacggaatagttaggaaacttccgttgatgtatttatttgcgata
agcttatcattttcagggttgtgtggcatcagttttatttggcacgaatcggcgtattta
agtattgtattacttttcgtaatgggatacttcatcggtaaaataaatcctcgaatcagt
gcgatagtgttgcaatcaattcctgagaaaagattggccgctgttgatggactattgaat
atggtcagtatgctcggagcaccggtgggacaacttctttttttaggaattgcaaatgta
gttggcattgcatatagttggtttgccttttcaataggttgctttttcttgattgtcata
attgtacttaaattcattaaaatggatgaaccaatgttttag

DBGET integrated database retrieval system