KEGG   Lactobacillus plantarum WCFS1: lp_0601Help
Entry
lp_0601           CDS       T00115                                 

Gene name
pepC1
Definition
(RefSeq) aminopeptidase C
  KO
K01372  bleomycin hydrolase [EC:3.4.22.40]
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lpl01002]
    lp_0601 (pepC1)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.40  bleomycin hydrolase
     lp_0601 (pepC1)
Peptidases [BR:lpl01002]
 Cysteine Peptidases
  Family C1: papain family
   lp_0601 (pepC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C1_2 Peptidase_C1
Motif
Other DBs
NCBI-GeneID: 1061565
NCBI-ProteinID: YP_004888597
UniProt: F9UL68
Position
complement(572690..574021)
Genome map
AA seq 443 aa AA seqDB search
MSKAISMNQIANFQADLDQRPEAKVIERSVTKNGILASSQDIQAMSQTTPVFSIDLDTGD
VANQKQSGRCWMFAALNTMRHSLAEKFNLKHFELSQNYTFFWDKFEKANYFYENVLATAD
QATSSRKVAWLMTTPQQDGGQWDMLVAIIQKYGIVPKSVMPETYNSSKSAEINSTLNLKL
RKDAVELRELVAAGTSDDAIQERKEKMLNEVYRMLAYAFGEPVSHFDWEYRDDKKQYHID
QNLTPQSFFEKYVGWNLDDYVSIINAPTDDKPYNHTYTIEMLGNVLGGREVKHLNVSMAD
FKQLAIKQLQAGQSVWFGCDVGQSSDRQKGVMATDVYSKDELFDVDLSMSKAERLDYGES
LMTHAMVITGVDLVDGQPTKWKVENSWGDKVGTKGFFVMSDAWMDEYCYQVVVNKEFLSD
DLKAAQAEEPTVLAPWDPMGALA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaagcaatcagtatgaaccaaattgctaactttcaagccgacttggaccaacgt
cccgaagcaaaagtcatcgaacgtagtgtcactaagaacggtatcttagcaagcagtcaa
gatattcaggccatgagccaaaccacaccagtattttccattgatttggatacaggtgac
gttgcgaaccaaaagcaaagtggtcgttgctggatgttcgccgctttaaacacgatgcgg
cattcattagctgaaaaattcaacttgaaacatttcgaactatcacaaaactacaccttt
ttctgggataagttcgaaaaagcgaactatttctatgaaaacgtgttggcaaccgctgac
caagcaactagcagccgtaaagttgcttggttgatgaccacgccacaacaagatggtggc
caatgggatatgctcgttgccattattcagaagtacggtatcgtgcctaagagtgtcatg
cctgaaacttacaacagttcaaaatcggctgaaatcaacagcacacttaacttaaagtta
cgtaaagatgccgttgaattacgtgaactagtggctgccggaactagtgacgacgcgatt
caagaacgcaaagaaaaaatgttaaacgaagtctatcgcatgttagcctatgcctttggc
gaacccgtttcacattttgactgggaatatcgtgatgataagaaacaataccacatcgac
caaaacttgacgccacaaagcttcttcgaaaagtacgttggctggaatttggacgattac
gtttcaatcatcaacgccccaaccgacgacaagccttataaccatacctacacgattgaa
atgttaggtaacgtcttaggtggccgtgaagtcaaacatttgaacgtgtctatggccgac
ttcaagcaattggccatcaagcaattacaagctggccaaagtgtctggtttggttgtgat
gttggtcaatcctccgaccgccaaaaaggggtcatggctaccgatgtctacagtaaagat
gaattattcgacgttgacctttcaatgtcgaaggctgaacgtcttgattacggcgaaagt
ctgatgacccacgccatggttatcaccggtgtcgacctcgttgacggccaaccaactaag
tggaaggttgaaaatagctggggcgacaaagttgggactaagggcttcttcgtcatgagc
gatgcttggatggacgaatactgctaccaagttgttgttaacaaggaattcttgtccgat
gacttaaaggcagcccaagccgaagaaccaactgttttagcaccttgggatccaatgggt
gcattagcctaa

DBGET integrated database retrieval system