KEGG   Lactobacillus plantarum WCFS1: lp_0602Help
Entry
lp_0602           CDS       T00115                                 

Gene name
rpiA1
Definition
(RefSeq) ribose 5-phosphate epimerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00030  Pentose phosphate pathway
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01120  Microbial metabolism in diverse environments
lpl01130  Biosynthesis of antibiotics
lpl01200  Carbon metabolism
lpl01230  Biosynthesis of amino acids
Module
lpl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lpl_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    lp_0602 (rpiA1)
Enzymes [BR:lpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     lp_0602 (rpiA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind AAA_30 UPF0181 AAA_assoc
Motif
Other DBs
NCBI-GeneID: 1061583
NCBI-ProteinID: YP_004888598
UniProt: Q88YY5
Position
complement(574097..574780)
Genome map
AA seq 227 aa AA seqDB search
MNQDQLKQLVGQKAVEYIQDGMQVGLGTGSTVKFMVDALGERVKNEHLNIVGVSTSDRTA
AQAKALGIPMKSVDEVDHLDLTIDGADEIADDFQGVKGGGAALLFEKIVAINSDKVMWIV
DESKMVHQLGAFGLPVEVIPYGSQHVFEKMAARGYNPVFRKVNDELVRTDSNNIIIDLHI
DPITDPHALAEDLIHMVGVVEHGLFLDMVNTVIVGHANGPEVIEARP
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggatcagttaaaacaacttgttggtcaaaaagccgttgaatacattcaagac
ggcatgcaggtcggcctcggaaccggctcaaccgttaaattcatggttgatgctctgggt
gaacgggtcaaaaatgaacatttaaacattgtcggcgtctcaacctccgaccgaaccgct
gcccaagctaaggcgctcggtatcccgatgaaatccgttgacgaagtcgaccatctcgac
ttaacgatcgacggtgccgacgaaatcgccgatgatttccaaggcgttaagggtggtggc
gccgccttactcttcgaaaaaatcgttgccatcaattctgataaagtcatgtggattgtt
gatgaaagcaaaatggtccatcaattaggtgcctttggcttacccgttgaagtgattcct
tacggcagccaacatgtctttgaaaaaatggctgcccggggctataacccagtattccgt
aaagtcaacgatgaactcgtccggaccgattctaataatattatcatcgatttacacatc
gacccaatcacggatccccacgctttagccgaagatttaattcacatggttggtgtggtt
gaacacggcctgttcttagacatggtcaacactgtcattgtcggtcatgccaatggtccc
gaggttatcgaagcacgaccatag

DBGET integrated database retrieval system