KEGG   Lactobacillus plantarum WCFS1: lp_0604Help
Entry
lp_0604           CDS       T00115                                 

Gene name
dut
Definition
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase
  KO
K01520  dUTP pyrophosphatase [EC:3.6.1.23]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00240  Pyrimidine metabolism
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    lp_0604 (dut)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_0604 (dut)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     lp_0604 (dut)
DNA repair and recombination proteins [BR:lpl03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    lp_0604 (dut)
 Prokaryotic Type
    lp_0604 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dUTPase
Motif
Other DBs
NCBI-GeneID: 1061576
NCBI-ProteinID: YP_004888600
UniProt: F9UL71
Position
575224..575760
Genome map
AA seq 178 aa AA seqDB search
MARGFEIVSQYAQAGLHVPYRTTKQAAGYDFEAAEDFTLPSIWKMNFIKVLWQIHHGETS
SAADLDAAAKVLKPWLVPTGIKAFMNEGEYLLLANRSSNPLKRNLILPNGIGVIDADYYN
NPKNEGAIFVQLINMGIRDVHIKKGERIAQGIFTPYLTVTDETNVTTTRSGGFGSTNK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcacggggatttgaaattgtaagtcaatacgcgcaggcggggttacatgtaccttac
cgcaccaccaagcaagcagctggctatgacttcgaagcggcggaagattttacgttaccg
tcaatttggaaaatgaactttatcaaagtactttggcaaatacatcatggtgaaacgagt
tctgcagccgatttggatgcggcggctaaagtccttaaaccatggcttgttccaacgggt
attaaggcatttatgaatgaaggtgaatacttactattagccaatcgttccagcaacccc
ttgaagcgtaacttgattctaccgaatgggattggcgtcattgacgctgactactataac
aatcccaagaacgaaggtgcgattttcgtccaattaatcaacatggggattcgcgacgtt
cacattaaaaagggtgaacgcattgcccaagggatttttaccccttatctgactgttacg
gatgaaacgaatgtgacaacgacacgttctgggggcttcggttcgaccaataaatag

DBGET integrated database retrieval system