KEGG   Lactobacillus plantarum WCFS1: lp_0606Help
Entry
lp_0606           CDS       T00115                                 

Gene name
radA
Definition
(RefSeq) DNA repair protein RadA
  KO
K04485  DNA repair protein RadA/Sms
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lpl03400]
    lp_0606 (radA)
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     lp_0606 (radA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPase AAA_25 ChlI DnaB_C Lon_C ABC_tran AAA_16 AAA_24 AAA_22 AAA_30 RecA Rad51 NTPase_1 DUF2075 IstB_IS21 AAA_14 NACHT AAA_5 Zeta_toxin AAA HypA DZR KTI12
Motif
Other DBs
NCBI-GeneID: 1061574
NCBI-ProteinID: YP_004888601
UniProt: F9UL72
Position
576649..578028
Genome map
AA seq 459 aa AA seqDB search
MAKAKTQFVCSNCGYSTPRYLGRCPNCGEWNTLTEEHFDTKPDRKSRVSFAGKSAKPQRL
KEVSLTKTPRVKTKLKEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSGQLAETGGSV
LYVTGEESASQVKMRADRLAVSSEDFYLYPETDMSNIRSTIESTHPEFVVIDSVQTMQEP
DMDSAIGSVSQIREITAELLQIAKTNGITIFIVGHVTKGGAIAGPKILEHMVDTVLYFEG
DLHHTYRILRAVKNRFGSTNELGIFEMRTGGLYEVANPSEIFLEERLKDATGSAIVVSME
GTRPILVEVQALVTPTVFGNAKRTASGLDHNRVSLIMAVLEKRASLMLQNQDAYLKAAGG
VKLDEPAIDLAIAVSVASSYRDQQTRPSDCFVGEVGLTGEIRRVNRIESRVGEAAKLGFK
RIFIPKNNLQGWDIPTGIEVIGVATLKEALQLALQQPNY
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaagcaaaaactcagtttgtttgttctaactgtggttattcaacaccgcgatat
ttaggacggtgtccgaactgtggtgaatggaatacactaactgaagaacattttgataca
aaaccggaccgcaagtcgcgggtgagctttgcgggtaagtcggctaagccacaacgactc
aaagaagtgtcgctgactaagacaccgcgtgtcaagactaagctgaaagagttcaaccgg
gtcttaggtggcggtgttgtgccaggttcactagttttgatcggtggtgatccaggtatt
ggtaagtcaacgttactactgcaagtttcggggcaattggccgagacgggtggttccgta
ctatacgtgactggtgaagaaagtgcctcccaagtgaagatgcgggcggaccggctggct
gttagcagtgaagacttttatctttatcctgagactgatatgtcgaatattcgttcaacg
attgaatcgacgcatccagaatttgtggtcattgattcggtacaaacgatgcaagaacct
gatatggactctgcgattggttcagtatcacaaatccgtgaaattacggctgaactactg
caaattgcgaagactaacggcattaccatttttattgtgggccatgtgactaagggtggt
gccattgcggggcctaagatcttagaacatatggttgataccgttttgtactttgaaggt
gatttacatcatacgtaccgcattttacgggcagtcaagaatcgattcgggtcaacgaat
gaactgggaatatttgagatgcggacgggcggtttgtatgaagtggccaatccgtcagag
atcttcttggaagaacgtctgaaggatgctacgggttccgccatcgttgtttcaatggaa
ggaacacgaccaatcttagtagaagttcaagcgctggtaacgccaacggtctttggtaat
gcgaagcggaccgcaagtggcttggatcataatcgagtctccttgattatggcagtgttg
gaaaaacgggcgagtctaatgcttcagaaccaggacgcgtatttgaaagcggccggtggc
gttaagttagatgaaccggcgattgacttagctattgcggtcagtgtggcttctagttat
cgtgaccagcagactcgtccgagtgactgttttgttggtgaagtcggtttgactggtgag
attcggcgggtcaaccggattgaatcacgagttggtgaggcggctaagctaggttttaaa
cgtatctttattcctaagaataatctgcaaggttgggatatcccaactggaatcgaagta
attggagttgccacgctaaaagaagcgctccaattagcattacaacaaccaaattattaa

DBGET integrated database retrieval system