KEGG   Lactobacillus plantarum WCFS1: lp_0613Help
Entry
lp_0613           CDS       T00115                                 

Definition
(RefSeq) nuclease, NYN_YacP family
  KO
K06962  uncharacterized protein
Organism
lpl  Lactobacillus plantarum WCFS1
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    lp_0613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN_YacP
Motif
Other DBs
NCBI-GeneID: 1061597
NCBI-ProteinID: YP_004888607
UniProt: F9UL78
Position
583896..584441
Genome map
AA seq 181 aa AA seqDB search
MKQQLLIVDAYNMIGNWPELNHLKQTDRLPQARDELISMLTEYKKITGLNISLVFDAMYV
PGNSKSYRQADLEIIWTSKDQTADSYIEKYAGEKQSRVLQVTVATSDQAEQWVIFSEGAL
RVPALELRHRVKTALKDVRHTAVRTQDLGAVRKSPWNDDQLSALDQYRQQLERNHVKHHH
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaattattgattgtcgatgcttacaatatgattggcaactggccagaactc
aatcatttaaaacaaacggaccggttgccgcaagctcgtgacgagttaattagcatgttg
actgagtataaaaaaattacgggccttaatattagcctggtttttgatgcgatgtacgtt
ccgggtaattctaagagttatcgccaagctgatcttgagattatttggacgagtaaagac
cagaccgctgacagttatatcgaaaagtacgcgggtgaaaagcaatcgagagtacttcaa
gtgacggttgcgactagtgaccaggcagaacaatgggtaatcttttcggaaggtgcatta
cgagtaccagccttggaattacgacaccgcgtcaagactgcgctgaaagatgtgcgtcat
actgccgtgcgcacccaggatttaggtgccgttcgtaaatcaccctggaatgatgatcaa
ttatcggccttggatcagtaccgccaacaactagaacgcaatcacgttaaacatcatcac
aagtaa

DBGET integrated database retrieval system