KEGG   Lactobacillus plantarum WCFS1: lp_0619Help
Entry
lp_0619           CDS       T00115                                 

Gene name
rplK
Definition
(RefSeq) 50S ribosomal protein L11
  KO
K02867  large subunit ribosomal protein L11
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03010  Ribosome
Module
lpl_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    lp_0619 (rplK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lpl03011]
    lp_0619 (rplK)
Ribosome [BR:lpl03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    lp_0619 (rplK)
  Bacteria
    lp_0619 (rplK)
  Archaea
    lp_0619 (rplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Motif
Other DBs
NCBI-GeneID: 1061614
NCBI-ProteinID: YP_004888613
UniProt: Q88YX0
Position
587629..588054
Genome map
AA seq 141 aa AA seqDB search
MAKKVANVVKLQIPAGKATPAPPVGPALGQAGINIMGFTKDFNARTADQAGMIIPVVITV
YEDRSFDFITKTPPAAVLLKKAAGVESGSGEPNTKKVATVTKDQVKQIAETKMQDLNAAD
VEAAMRMIEGTARSMGFTVEG
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaaaaagtagctaacgttgttaaattacaaattcctgcgggcaaagcaacacct
gctccgccagttggcccagctttaggtcaagcaggtatcaatatcatgggtttcacaaag
gatttcaatgctcgtactgctgatcaagcaggtatgatcatccctgttgtgattacggtg
tacgaagatcgttcattcgacttcatcactaagaccccacctgctgccgttctattgaag
aaagctgccggtgttgaaagtggttccggtgaacctaacacgaagaaggttgcaactgta
accaaagatcaagttaagcaaatcgccgaaactaaaatgcaagatctaaacgcagctgac
gttgaagcagctatgcgcatgatcgaaggtactgctcggagtatgggattcaccgtcgaa
ggctaa

DBGET integrated database retrieval system