KEGG   Lactobacillus plantarum WCFS1: lp_0628Help
Entry
lp_0628           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 5, superinfection exclusion (cell surface N-anchored)
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_Ltp Miff Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 1061658
NCBI-ProteinID: YP_004888620
UniProt: F9UL91
Position
complement(593481..594527)
Genome map
AA seq 348 aa AA seqDB search
MSKDNAEEYHRSYKAKKPFYKRVWFWALAVIVIFIVGGSLGGKDNSNATNNAGKTTSASD
SQNTKVYSTQDLKVTVSKAIVHNTDWLIKGKTKAPNNSKIAAVIIDNSSDAITDIPISTS
DDIKWAKVKDGNFSAYIEPLQAFNASKRHAGDTVTVYIVALENYEKKDTDTIPAHVRKQI
KKTKPYTLTLTKAQADYQNSLDGSKKDSKKASSSSSKETSSSSNIDKNDDSESLSSSNSS
TSSSKVSSEDKAALEKAQDYATEMNMSKQGVYEQLTSSAGEGFSSEAAQYAVNHLTDIDW
NANALAKAKDYQSEMSMSRSAILDQLTSSAGEQFTQSQAQYAIDHLPK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagataatgctgaagaataccacagatcatataaggcaaagaaacctttttac
aaacgagtctggttttgggctttagcggtaatcgtcatttttatagtcggcggatcattg
ggtggcaaagacaattccaatgccacaaataacgctggcaaaacaactagcgcatcagat
agccagaacacaaaagtttatagcactcaagatttgaaagttactgtttcaaaagcaatt
gtacacaacacagattggcttattaagggaaaaacaaaagccccaaataactcaaaaatt
gcagctgtcataatagataattctagtgatgcaataactgacataccgatttcaacatct
gatgatattaagtgggctaaggtcaaagacggtaatttttcagcatatattgaaccatta
caagcctttaatgcaagcaaacgacatgcaggagatacagtaactgtctatattgttgcc
ctagaaaattatgaaaaaaaagacacggatactatccctgcccatgtacgtaaacaaatt
aagaaaacaaaaccatatacgttaaccttgactaaggcccaagcagattatcagaatagt
ctggatggctccaaaaaagattctaaaaaagcaagttcttcaagttccaaagagactagc
tcatcatctaatattgataaaaatgatgattctgaatcgttatcttccagcaacagctca
actagctccagtaaagtcagctcagaggataaagctgctttagaaaaagctcaggattat
gcaaccgaaatgaacatgtcaaagcaaggcgtatatgagcaactcacctcatctgctggt
gaaggcttctcctcagaggctgcacagtatgctgttaatcatctaaccgatatcgactgg
aatgctaacgctctagcaaaagctaaagattaccaaagtgaaatgtccatgtcacgtagt
gcaattcttgaccaattaacatcgtcagctggtgagcaatttactcagtctcaagcacaa
tacgccattgaccatttaccaaaataa

DBGET integrated database retrieval system