KEGG   Lactobacillus plantarum WCFS1: lp_0632Help
Entry
lp_0632           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 9, phage Cro/CI family transcriptional regulator
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 Sigma70_r4_2 HTH_psq HTH_23
Motif
Other DBs
NCBI-GeneID: 1061712
NCBI-ProteinID: YP_004888624
UniProt: F9UL95
Position
595961..596191
Genome map
AA seq 76 aa AA seqDB search
MRHWLKEWRDINGLTQKKAAEFLDMPETTLASYEQGHRTPSVGRAKKMAVRMNDISKKKR
VKWTYFFEDKVHNTSK
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcattggttaaaagagtggagagacatcaacggactaacgcaaaaaaaggctgct
gaatttctcgatatgccagagacaactttagcgtcttacgaacaagggcatagaacacca
agtgttggtagagctaagaaaatggctgtaagaatgaacgatatatcgaaaaaaaaacgt
gttaaatggacttatttttttgaagataaagtacacaatacgagtaaataa

DBGET integrated database retrieval system