KEGG   Lactobacillus plantarum WCFS1: lp_0633Help
Entry
lp_0633           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 10
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2442
Motif
Other DBs
NCBI-GeneID: 1061706
NCBI-ProteinID: YP_004888625
UniProt: F9UL96
Position
complement(596264..596578)
Genome map
AA seq 104 aa AA seqDB search
MLTATIHFLDGETLTLNVHDFVWGIRTAPINDRPKKFSKKNWEKITYDFPNKDEINGPFE
LNEHIKLGLVPSITKLLNNYTFFFTDDDPGTVFASSKVVKIVSH
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagctacgattcattttttagatggtgaaacactaacgctaaacgtacatgac
tttgtttggggtattcgcactgcgccaattaatgatcgtcctaaaaaattttctaaaaag
aactgggaaaagataacgtacgattttcctaacaaagacgaaattaatggtccgtttgaa
ctgaacgaacatattaagctaggattagtgccaagtatcaccaaacttctaaacaactac
actttctttttcactgatgatgaccctggcaccgtgtttgccagctccaaagtggtaaag
attgtcagtcattaa

DBGET integrated database retrieval system