KEGG   Lactobacillus plantarum WCFS1: lp_0635Help
Entry
lp_0635           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 12, phage transcription regulator
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31 HTH_19 HTH_26 HTH_25 HTH_37 YdaS_antitoxin HTH_24 HTH_23 HTH_38 Sigma70_r4 MarR_2 MarR HTH_psq DUF4859 MqsA_antitoxin NUMOD1 Phage_AlpA
Motif
Other DBs
NCBI-GeneID: 1061759
NCBI-ProteinID: YP_004888627
UniProt: F9UL98
Position
596999..597199
Genome map
AA seq 66 aa AA seqDB search
MTYTLRIRELRQKLGLSQSALADKSGVPQTTISAIESGTNLTYETAKKLARALGVSTDEL
SVEVTE
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgacttacacattaaggattcgagaattgcggcagaaactgggactcagccaatcagca
ctagctgataaaagtggagtaccgcaaacgacgatcagcgcaattgagtcaggtactaat
ttgacatacgagacggcgaaaaagcttgcccgtgcattgggagtttccacagatgaatta
tcagtggaggtgaccgagtaa

DBGET integrated database retrieval system