KEGG   Lactobacillus plantarum WCFS1: lp_0637Help
Entry
lp_0637           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 14
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAL_decarboxy
Motif
Other DBs
NCBI-GeneID: 1061751
NCBI-ProteinID: YP_004888629
UniProt: F9ULA0
Position
597601..598155
Genome map
AA seq 184 aa AA seqDB search
MSTQSSSVFAGSTLTDVMNHNSVAPIELSGKVGYSVTLIYKQRHDQARIRIESVPAFLAA
LPNQNQFFAIELAHRFVGVTTPVIDGDRIMKEPLAMAVKTMPELSQALAAIQDSLDELTI
PKEDLKPNDFDDPKKLVAECFDAVLYLLNLIAYVCRGFDLSMQDQLKQRMKKWFKDGVVK
HRKE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacagtctagctcagtatttgcaggtagcacgttgactgatgtaatgaatcat
aacagcgtagcgcctattgaactgagcggcaaggtaggctactcagtaacgcttatttac
aaacaaaggcatgatcaggcacgtattcgaatagaatcagtaccagcatttctagcagca
ttacctaatcaaaatcaattctttgcaattgaattggcacatcgatttgtcggcgttacg
acgccagtgattgatggcgaccgaattatgaaggaaccattagcaatggctgttaaaact
atgccggaattaagccaagcactagcggctattcaggattcacttgatgaactaacgata
cccaaagaggatttgaagccaaatgactttgatgatcccaaaaaattagtcgctgagtgt
tttgatgcagtgctttacttgttaaacctaatcgcatacgtgtgtcgtggctttgatttg
tctatgcaagatcagcttaaacagcgaatgaaaaaatggtttaaagatggagtcgttaaa
cataggaaggagtga

DBGET integrated database retrieval system