KEGG   Lactobacillus plantarum WCFS1: lp_0639Help
Entry
lp_0639           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 16
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 11933289
NCBI-ProteinID: YP_004888631
UniProt: F9ULA2
Position
598514..598684
Genome map
AA seq 56 aa AA seqDB search
MKLLVGLEFKEMKTMKFTFRIGNVLYKQITIEELNNVFGTFKEVERIGSTQSIAKA
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgctagttggtttggaatttaaggagatgaagacgatgaaatttacattccgg
attggaaacgtgctttacaagcaaatcacaattgaagaattgaataatgtttttggcaca
tttaaggaggtcgaacgaattggaagtacgcaaagtatcgctaaagcctaa

DBGET integrated database retrieval system