KEGG   Lactobacillus plantarum WCFS1: lp_0640Help
Entry
lp_0640           CDS       T00115                                 

Definition
(RefSeq) prophage P1 protein 17
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_38N
Motif
Other DBs
NCBI-GeneID: 1061781
NCBI-ProteinID: YP_004888632
UniProt: F9ULA3
Position
598817..599203
Genome map
AA seq 128 aa AA seqDB search
MIPAQAGLNEHWQQRNDSRDWVLDADNYCYDGDEFDKAQLFQDYIDNNDFEQWATDMQAD
MLSAICIVTFGSTDVSVLYPDQGEEPNWQWLIDVFGQSRLWDELLVHIDTDTMMTRLGYH
WVSEGEEA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgataccagcacaggcaggtttaaacgagcattggcagcaacgtaacgactcacgtgac
tgggtacttgacgcagataactattgctacgatggtgacgagttcgacaaagcacagttg
tttcaagattacattgataacaatgactttgagcagtgggcgactgatatgcaggccgat
atgttaagtgccatttgtatcgtcactttcggttcgactgacgtaagtgtgttgtatcca
gatcaaggtgaggaacctaattggcaatggttgattgatgtgtttggtcagtcccgtcta
tgggacgagctactggtacacatcgacacggacacgatgatgacacgtctgggctatcac
tgggtatcagagggggaagaagcatga

DBGET integrated database retrieval system