KEGG   Lactobacillus plantarum WCFS1: lp_0785Help
Entry
lp_0785           CDS       T00115                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN F420_oxidored AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 1063780
NCBI-ProteinID: YP_004888759
UniProt: F9UM06
Position
complement(719630..720604)
Genome map
AA seq 324 aa AA seqDB search
MTKVFIAGQLPAQANTLLLQSQLVIDTYTGDNLISHAELIRRVADADFLIIPLSTQVDQD
VLDHAPHLKLIANFGAGTNNIDIAAAAKRQIPVTNTPNVSAVATAESTVGLIISLAHRIV
EGDHLMRTSGFNGWAPLFFLGHNLQGKTLGILGLGQIGQAVAKRLHAFDMPILYSQHHRL
PISRETQLGATFVSQDELLQRADIVTLHLPLTTQTTHLIDNAAFSKMKSTALLINAARGP
IVDEQALVTALQQHQIAGAALDVYEHEPQVTPGLATMNNVILTPHLGNATVEARDGMATI
VAENVIAMAQHQPIKYVVNDVTPA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagtctttattgctggtcagcttccagcccaagctaatacgttacttttacaa
agtcagttagtcattgatacttataccggcgataacctgatcagtcacgcggaactcatc
cgtcgagtcgctgatgccgactttttgattatcccactctcaactcaagtagatcaagat
gtcttagaccacgccccacaccttaaactgattgctaattttggtgctggcactaataac
atcgatatcgcggcagcagctaagcgccagattccagtcacgaacacgccaaacgtttcg
gcggtcgcaaccgctgaatcaacggtcggtttgattatcagcctagcgcatcgtatcgtg
gaaggcgatcacttaatgcgaactagcggctttaacggttgggcgccactattctttctc
ggccacaacttacaaggcaagacactcggcatcttaggccttggccaaattggtcaagcc
gttgccaaacgattacacgcctttgacatgcccatcttatacagccaacaccaccgccta
ccgattagccgtgaaacgcaacttggcgcaacctttgtctcccaggatgaacttttacag
cgtgccgacatcgtcactttacacctgccgcttaccacacaaacaacccatctaatcgat
aacgctgcttttagcaaaatgaagtccacggcgctcctcatcaacgccgcacgggggcca
attgtcgacgagcaagcacttgtgacggcgctgcaacaacatcaaattgctggcgctgca
ctcgacgtctacgaacatgaaccgcaagtcacacctggtttggccacgatgaacaacgtc
attttgacacctcatcttggcaacgcaacggtcgaagctcgcgatggcatggctaccatt
gtcgcggagaatgtgattgcgatggcccaacatcagccaatcaagtacgtggttaacgac
gtaacaccagcatag

DBGET integrated database retrieval system