KEGG   Lactobacillus plantarum WCFS1: lp_2197Help
Entry
lp_2197           CDS       T00115                                 

Gene name
murD
Definition
(RefSeq) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00471  D-Glutamine and D-glutamate metabolism
lpl00550  Peptidoglycan biosynthesis
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    lp_2197 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lp_2197 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
    lp_2197 (murD)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     lp_2197 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lpl01011]
 Precursor biosynthesis
  Amino acid ligase
   lp_2197 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 1063555
NCBI-ProteinID: YP_004889930
UniProt: Q88V80
Position
complement(1983865..1985244)
Genome map
AA seq 459 aa AA seqDB search
MKSVEQYRNQKVLVLGLAKSGVNAARLLHKLGAFVTVNDKKKFDENPDAQELLSDGIKVI
TGGHPLSLLDEDFKVVVKNPGIPYSNPIVSGAQEKGIPVITEVELASQILAGELIGVTGT
NGKTTTTTMITMMLNQRTNAGKAYVAGNIGVPASAIAQKATAADTMVTELSSFMLCGIQT
LHPHIAVITNIYSTHLDYHGSRENYVKAKMRITMNQTANDYLVINWDSEEWRQLSKQSQA
TVVPFSRQANTKDGAYEEAGKLYFKDEYIMDAADIRIPGDHNVENALAAIAVAKLQAVPT
AGIVQVLKTFTGVRHRTQYVETYQDRQFYNDSKATNLVSTEMALKGFDQPVILLAGGLDR
GNTFEKLAPALKAHVKTLIVFGETAEKMADAGRLAGIQDIEFTDNCETAVPIAWQHSQAG
DIIMLSPACASWDQYPNFEVRGDRFIKAIEQLTGKAEEN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggttgagcagtatcgtaaccaaaaggttttggttcttggattagcaaagagc
ggggtcaatgccgcacggttgctccacaaattaggtgcgtttgtgaccgttaatgataaa
aagaaatttgatgagaacccggatgcacaggaattattgagtgatggaatcaaagttatc
acgggtggtcacccgctgtcactactagatgaagattttaaagttgttgtcaagaacccg
ggtattccatactcaaatccaattgtgagtggggctcaggaaaagggtattccagtcatt
accgaagttgagcttgcatcgcaaatcctagcgggagagttgattggtgtgacggggacg
aacggtaaaaccacgacaacgacgatgatcacgatgatgcttaatcaacgcacaaatgcc
ggtaaagcttacgtggcaggtaatattggcgtgccggcctcagcaattgcacaaaaggct
acggcggccgacacaatggtgactgagctttcgagttttatgttgtgtggtattcaaact
ttgcacccacatattgcggtgattacgaatatttattcgacgcatttggattaccatggc
tcacgtgagaactatgtcaaggcaaagatgcgaatcaccatgaaccaaacggctaatgat
tatctagtcattaattgggatagtgaagaatggcggcaactcagtaagcaatcacaagca
accgtcgtgccattttcacggcaagccaatacgaaagatggcgcctatgaagaggccggc
aagctgtactttaaagatgagtacatcatggatgctgctgatatccggattcctggtgat
cataatgttgaaaatgcgttagcagcgattgccgttgctaaacttcaagccgttccaaca
gcaggaatcgttcaagtcttgaagacgtttacgggtgttcgacaccggactcaatatgtc
gagacgtatcaggaccggcaattttacaacgattccaaagcaaccaacttggtgtcgacc
gagatggccttgaagggctttgatcagccggtcattttacttgctggtggtttggaccgt
ggtaatacgtttgaaaagcttgctcccgcattaaaggcgcatgtcaagacgttaatcgtc
ttcggtgagactgctgaaaaaatggcggacgctgggcgtttggctggtattcaagatatt
gagtttacggacaactgtgagactgcggtgccaattgcttggcaacatagtcaggctggt
gacatcatcatgttatcaccggcttgtgccagttgggatcagtacccgaacttcgaagtg
cggggcgaccgatttattaaagcaatcgaacagttaactggaaaggcggaagaaaactaa

DBGET integrated database retrieval system