KEGG   Lactobacillus plantarum WCFS1: lp_2267Help
Entry
lp_2267           CDS       T00115                                 

Gene name
xtp1
Definition
(RefSeq) xanthosine triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    lp_2267 (xtp1)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     lp_2267 (xtp1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-GeneID: 1062219
NCBI-ProteinID: YP_004889989
UniProt: Q88V20
Position
complement(2047589..2048197)
Genome map
AA seq 202 aa AA seqDB search
MTKPQTLIIATNNANKAREFSAMLAPYDITIKTLADFPNIPEIKENGITFEENATKKATV
VVEATGLPAIADDSGLMVKALHGDPGVFSARYAGDHDDAANNAKLLANLGGVPEAERTAT
FHTTLVALKPSGEKLVVNGELAGRILIAPRGDNGFGYDPLFWSSKFQKSLAELTPAQKNQ
ISHRGAALRQLMTKFDEWWAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaccacaaacattgatcattgcgactaacaatgccaataaggcgcgcgagttt
agcgcgatgttggcaccgtatgatattaccatcaaaacgttggctgattttccaaatatt
cctgaaattaaggagaacggtatcacgtttgaagaaaatgccactaaaaaggcgacggtt
gtggtcgaagcaaccggattaccggcaattgcggatgattccggcttgatggtcaaggcg
ttgcacggtgatccgggagtgttctcggcacggtatgctggtgatcatgatgatgctgcg
aataatgccaagttgttagccaaccttggtggcgttcctgaagcggagcggaccgcgact
tttcatacgaccctggttgcccttaaacccagtggtgagaaacttgtcgttaacggtgag
ttagccggccgtattctgattgccccccgtggtgacaatgggtttggttatgatccgtta
ttttggtcaagtaagtttcaaaaatccttggcggaattgacgccagcacaaaaaaatcaa
atcagtcatcggggtgcagccttgcgacaactgatgactaaattcgatgaatggtgggcg
aaagcatga

DBGET integrated database retrieval system