KEGG   Lactobacillus plantarum WCFS1: lp_2287Help
Entry
lp_2287           CDS       T00115                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction ATP-dependent DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lp_2287 (ruvA)
Enzymes [BR:lpl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lp_2287 (ruvA)
DNA repair and recombination proteins [BR:lpl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     lp_2287 (ruvA)
    RecFOR pathway proteins
     lp_2287 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_2 HHH_3 HHH_8 5_3_exonuc IMS_HHH WIYLD DUF3701 RE_Alw26IDE
Motif
Other DBs
NCBI-GeneID: 1062295
NCBI-ProteinID: YP_004890007
UniProt: Q88V02
Position
complement(2065177..2065788)
Genome map
AA seq 203 aa AA seqDB search
MYEYFLGQVTDVTPGYVVIEVSGIGYKVLTANPYRYQVGPTAVKMYIHQAVSENGMSLFG
FFDADEKALFEKLLGVSGIGPKSALAILANNDHAGLIQAINQENATYLTSFPGVGKKTAQ
QIVLDLKGKLNDLNVDVTGQTALDVDAPAVDGALADALAALEALGYSKADVKKVTKKLET
FSQTQGADTNTLLSEGLRLLMKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaatattttctcggtcaagtgaccgatgtaacccccggttatgtggtgattgag
gtcagcggcattggttataaagtgctaacggctaatccataccgttaccaggtgggccca
acagcagttaagatgtatatccatcaagccgtcagcgaaaatggcatgagcctatttggc
ttttttgatgctgacgagaaggcgttgttcgaaaagttgctcggggtttcgggaattggt
ccgaagtcggccctcgcgattttggccaacaacgaccatgcaggtctgatccaagccatc
aatcaagagaatgcgacttatctgacgagttttcctggcgtgggcaagaagacagctcag
caaatcgtactggacttgaaaggtaaattaaacgatctaaacgttgatgtgactggtcaa
actgcgctcgatgtggatgctcctgctgttgatggcgcgttagcggacgcgttggcggct
ctggaagctcttggctattcgaaagcggatgtcaagaaggtcactaagaagttggagacg
tttagtcagacacaaggggccgatacgaacaccttgttgagtgaaggactacgactattg
atgaagaagtag

DBGET integrated database retrieval system