KEGG   Lactobacillus plantarum WCFS1: lp_2700Help
Entry
lp_2700           CDS       T00115                                 

Gene name
pyrAB
Definition
(RefSeq) carbamoyl-phosphate synthase,pyrimidine-specific, large chain
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00240  Pyrimidine metabolism
lpl00250  Alanine, aspartate and glutamate metabolism
lpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lp_2700 (pyrAB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lp_2700 (pyrAB)
Enzymes [BR:lpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     lp_2700 (pyrAB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 ATPgrasp_Ter ATP-grasp_3 MGS Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_4 ATP-grasp_5 GAPES3
Motif
Other DBs
NCBI-GeneID: 1062982
NCBI-ProteinID: YP_004890335
UniProt: P77886
Position
complement(2400653..2403829)
Genome map
AA seq 1058 aa AA seqDB search
MPKRTDIHKIMVIGSGPIIIGQAAEFDYSGTQACLALKELDYEVVLVNSNPATIMTDKEI
ADQVYLEPITLEFVSQILRKEHPDAILPTLGGQQGLNMAMELSKSGILDELHIELLGTKL
SAIDQAEDREQFKALMEELGEPVPASGIARTVDEALAFAKQAGYPVIVRPAFTMGGTGGG
IAETPQQLHDITENGLALSPVTQVLIEQSIAGYKEIEFEVMRDAADNAMVVCNMENFDPV
GIHTGDSIVYAPVQTLADREVQLLRDAALKIIRALKIEGGCNVQLALDPNSFNYYIIEVN
PRVSRSSALASKATGYPIAKMAAKIAVGLHLDEIKNPVTGTTYAEFEPALDYVVCKIPRW
PFDKFTHADRRLGTQMKATGEVMAIGRNIEEATLKAVRSLEIGVHHVEEPALRSVDDDVL
SDKLIHAQDDRLFYLTEAIRRGYPIDELAELTKINVFFLDKLLHIIEIEQALRTHTDDIE
TLTVAKRNGFADQTVADYWHETIDQVRDFRLAHKLAPVYKMVDTCAGEFASETPYYYGTY
EFENESIVTKRPSVLVLGSGPIRIGQGVEFDYATVHSVKAIQKAGYEAIIMNSNPETVST
DFSVSDKLYFEPLTIEDVLNVIELEKPVGVIVQFGGQTAINLAKPLADHGIKILGTSVAD
VNRAEDRDEFDKVIKALAIPQPAGDTASDEATALAIADKLGYPVLVRPSYVLGGRAMEIV
KKRTDLDYYMHNAVKVSHDHPVLVDSYLVGKECEVDAICDGQTVLIPGIMEHIERAGVHS
GDSMAVYPPQSLSAAVQAQIVDYTEKLAIALNCVGMMNIQFVIHDDQVYVIEVNPRASRT
VPFLSKVTNIPMAQVATRAILDQSLAEQGYQTGLVTPGPLVHVKAPVFSFSKLNRVDSLL
GPEMKSTGEVMGSDVTMAKALYKAFEAAKLHVPSHGNVLLTVRDEDKPETVALAKRFHAL
GYQLLATRGTATALTTHGLPVTTVDKIDSGERDLLHRMEAGEIQVVINTVSDEEQAENDG
TLIRNTSIMHGIPLFTALDTVAAILQVRESQSFVTQAL
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaacggacagatattcataaaattatggtaattggttcaggaccaattattatt
ggtcaggccgcagaatttgattattctgggacacaagcttgcctggcattaaaagaactc
gattatgaagtggtcttggtcaattctaaccccgcaacgattatgacggacaaagaaatt
gcggaccaggtctacttggaaccaattacacttgaatttgtttcacagattctccgcaaa
gaacatccggatgcgattttgccaactttaggcggccagcagggcttgaatatggcgatg
gaattatctaaatcgggtattctcgatgagttgcacattgaactgttaggaacgaagctc
agcgcaattgatcaggcggaagaccgggaacagtttaaggcactgatggaagaattgggc
gaacccgtgccagcttctggtattgcgcggacggttgacgaagcgttggctttcgctaag
caagctggttatccggtcatcgtgcgaccagcctttacgatgggggggactggcggtggc
atcgccgagacgccccaacagttacacgacattaccgaaaatgggttggcgttatcacca
gtgacccaagttctgatcgaacaaagtattgccgggtacaaagaaattgagtttgaagtt
atgcgtgatgctgcggataatgcgatggtcgtctgcaatatggaaaattttgaccccgtg
gggattcataccggtgattcaatcgtctatgcacctgttcaaacgttagcagatcgcgaa
gtgcaattattacgggatgctgctttgaagattattcgggcgttgaagattgaggggggc
tgtaacgttcagttggccctcgatcctaatagttttaattactatattattgaagtaaat
ccgcgggtcagtcgctcatcagcgttagcctccaaagcgactggttacccaattgctaag
atggctgccaagattgcagtcggcttgcatttggatgaaattaaaaatccggtgacggga
accacttacgctgaattcgagccagcgttggactacgtggtttgcaagattcctcgctgg
ccgtttgataagttcacccatgctgatcgtcgtttgggcactcagatgaaggcgaccggc
gaagtcatggcgattgggcgcaatattgaagaagccacactaaaggcggtccgatcacta
gaaattggggtgcaccacgttgaagaacccgctttgcgtagtgttgacgatgatgtactc
agcgataagctcattcatgcgcaggatgatcggttattctacttaacggaagcaattcgc
cgcggttacccgattgatgaattagccgaactcaccaagatcaacgtgttcttcctggat
aaactattacacattattgaaatcgaacaagccttgcgtacccatacggatgacatagag
acactaactgtcgctaaacgcaatggcttcgccgatcaaacggtagctgactattggcac
gaaacaatcgatcaggttcgcgacttccgcttagcgcacaaactagcgcccgtttataag
atggtcgatacttgtgccggtgagtttgcttcggagacaccttattactacggcacttat
gagtttgaaaatgagagtattgtcacgaaacgcccatccgttttagtgttagggtcaggg
ccgattcgcattgggcaaggggtggaattcgactatgctaccgttcactccgttaaagcc
atccaaaaagctggctatgaagcgattatcatgaatagtaatccggaaaccgtctcgact
gatttctcagtatcagacaaattgtacttcgagccactgacgattgaagatgtcttaaac
gtgatcgaacttgaaaaaccagtgggcgtgattgtgcaatttggtggtcaaacagcgatt
aacttagcgaaaccattggctgaccatggtatcaaaatcttagggacgagtgtggcggat
gtcaaccgcgcggaagaccgtgacgaatttgataaggtcatcaaagctttagctattcca
caaccggctggtgatacggcaagtgatgaagcaaccgcgctagctattgcggataagttg
ggctatcccgtccttgtccggcccagttatgtccttggtggccgggcgatggaaattgtc
aagaagcggaccgacttagactattacatgcataacgcggtcaaggtgtcgcacgaccac
cccgttttagtggacagttatttggtcgggaaggaatgtgaagttgatgccatttgtgac
ggtcaaacagtcttgattccgggaattatggaacacatcgaacgggcgggtgtccattct
ggcgattcgatggccgtttatccgccacagtcactttcggcggcggtccaagcacaaatt
gtggattatactgaaaaattagccattgcgctcaactgtgtcgggatgatgaacattcaa
ttcgtaatccacgacgaccaagtttatgtgattgaagtcaatccgcgcgcgagccggacg
gtgccattcttaagcaaggtcacgaacattccgatggctcaagttgcgactcgggcaatc
cttgaccagtcattggctgaacaaggttatcagactggcttggtcacaccgggtccctta
gtacacgtcaaagcgccggtcttttcattttcaaagttgaatcgtgtggatagtttgttg
ggaccagaaatgaagtcaacgggtgaagtcatgggcagcgatgtcacgatggcaaaggcg
ctttacaaagcctttgaagcggctaagctacacgtgccgagccatggtaacgtacttttg
actgtccgggatgaagacaagccagaaacagtggcgttagccaagcggttccatgcgttg
ggttaccaattgctagcgactcggggaacggcgactgctctgaccacacacgggttaccc
gttacgaccgtcgacaagatcgatagtggcgagcgtgatttactgcatcgcatggaagct
ggcgaaattcaagtcgtcattaatacggtttcggatgaagaacaggctgaaaatgatggt
accctgattcgaaacacgtcaattatgcacggtattccgttgtttacggccttagatacg
gtcgcggcaattttgcaagtacgagaatcacaatcatttgtaacgcaggcgctctaa

DBGET integrated database retrieval system