KEGG   Lactobacillus plantarum WCFS1: lp_2790Help
Entry
lp_2790           CDS       T00115                                 

Definition
(RefSeq) 2-hydroxyacid dehydrogenase
Organism
lpl  Lactobacillus plantarum WCFS1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored XdhC_C
Motif
Other DBs
NCBI-GeneID: 1063125
NCBI-ProteinID: YP_004890410
UniProt: F9URQ7
Structure
PDB: 

Position
complement(2479995..2480945)
Genome map
AA seq 316 aa AA seqDB search
MPMVLMAQATKPEQLQQLQTTYPDWTFKDAAAVTAADYDQIEVMYGNHPLLKTILARPTN
QLKFVQVISAGVDYLPLKALQAAGVVVANTSGIHADAISESVLAAMLSVVRGYHAAWLNQ
RGARQWALPMTTSTLTGQQLLIYGTGQIGQSLAAKASALGMHVIGVNTTGHPADHFHETV
AFTATADALATANFIVNALPLTPTTHHLFSTELFQQTKQQPMLINIGRGPAVDTTALMTA
LDHHQLSMAALDVTEPEPLPTDHPLWQRDDVLITPHISGQIAHFRATVFPIFAANFAQFV
KDGTLVRNQVDLNRGY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccaatggtattgatggctcaagcaaccaaacctgaacagctgcaacagttacaaacc
acttatccggactggacgttcaaggatgcggcggcggtcacggcggccgattacgaccaa
attgaagtcatgtatggtaatcatccgttattaaagacgatcctagcgcggccaaccaat
cagttaaagtttgtacaggtcatttcagctggcgtcgattatttgccattaaaggcattg
caagcggccggggtggtggttgcgaacacgagtggtattcacgccgatgcgattagtgaa
tcggtcttagccgcgatgttaagcgtagtccgggggtaccatgcggcctggctgaatcag
cgcggggcacggcaatgggccttgccaatgacgacatctaccttgaccgggcaacagttg
ttgatatatggcacgggccaaattgggcaatcgttagcggctaaggctagtgcgttaggc
atgcacgtgattggggtcaatacgaccggtcaccccgctgatcattttcatgaaacagtg
gcatttaccgcgacggctgacgcgttagcaacggctaactttattgtcaacgctttgcca
ttaacgccaacaacgcatcatttgtttagtactgaattatttcagcagaccaaacagcaa
ccgatgttgattaatattgggcgtggtccggcggttgatactacagcgttaatgaccgcc
ctggatcatcatcaactcagtatggcagcgttggacgttactgaaccagagccattaccg
acggaccacccgttgtggcaacgagatgacgtgctgattacgccacatatttcaggtcaa
attgcccactttcgggcgaccgtttttccaatctttgcggcgaactttgcacagtttgtc
aaagatggcacgctggtacgtaaccaagtggatctgaatcgtggttattaa

DBGET integrated database retrieval system