KEGG   Lactobacillus plantarum WCFS1: lp_3418Help
Entry
lp_3418           CDS       T00115                                 

Gene name
pck
Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
lpl  Lactobacillus plantarum WCFS1
Pathway
lpl00010  Glycolysis / Gluconeogenesis
lpl00020  Citrate cycle (TCA cycle)
lpl00620  Pyruvate metabolism
lpl01100  Metabolic pathways
lpl01110  Biosynthesis of secondary metabolites
lpl01120  Microbial metabolism in diverse environments
lpl01130  Biosynthesis of antibiotics
lpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp_3418 (pck)
   00020 Citrate cycle (TCA cycle)
    lp_3418 (pck)
   00620 Pyruvate metabolism
    lp_3418 (pck)
Enzymes [BR:lpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     lp_3418 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP ABC_tran AAA_33 AAA_29
Motif
Other DBs
NCBI-GeneID: 1063745
NCBI-ProteinID: YP_004890913
UniProt: F9UU97
Position
3033341..3035002
Genome map
AA seq 553 aa AA seqDB search
MSTKNSYQLADIGRHNPIFSQIRSTVETAFYGNNMHHVDDIAAAYHRATKDPGTVITDLP
IYRATDLGLPADAKMLIANTGKVVGRTAQARRILGNPGVSEADMAGRLRQALFASAHKDF
ITTDVLVGLDEDFIVRAHLAIPDGFANNLLSYMLNFQPITAAYQEMFDRSVAYPEGDIYI
YADPTYHDPDYPDGLAIFDPQHNTAAILGMPYFGELKKSTLTLAWSIAHRHGFVACHGGL
KAFHFKDKQDQVFAMFGLSGSGKSTLTHAKHGYKYDITVLHDDAFVINRKDGSSVALEPS
YFDKTNDYPMTSDETKYFMTIQNVGVTLDDQGRKVLVTEDLRNGNGRTIKSRYASTNRVD
KEAAPINAIFWIMKDDSLPPVIKVDDPVLAATFGATLATKRSSAENIIGNVDRNALVIEP
FANPFRVYPLSEDYHDFKALFEERHLDCYLLNTGFFGDKKIPKEITLGALEAIVNDTTEW
ESFAGLEHMQNLKLADFPVDYANADYRNLVATRLGIRANFIDQYQHNNHDQLPHEITDIL
VHLQDQLKQPITK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaaaaattcttatcaattagccgatatcggtcgccataatccgatcttttca
cagatccgttctaccgtcgaaacggccttttacggtaataatatgcaccacgttgatgat
atcgctgccgcttaccaccgcgctactaaggaccccggaaccgttattacggacctccca
atctatcgcgcaacggatttaggcttaccagctgatgcaaaaatgttgattgccaatacg
ggtaaggttgttggccgaaccgcacaagcgcgccggattctaggcaacccgggtgttagc
gaagccgatatggccggtcgcctacgccaagcactatttgctagtgctcacaaggacttc
atcacgacggacgttctggtcggtttagacgaagacttcatcgtgcgggcccacctcgcg
attccggacggttttgccaataatctactttcttacatgcttaacttccagcccatcacc
gctgcttatcaagaaatgttcgatcggtccgttgcttatccagaaggcgatatttacatt
tacgctgaccctacttaccatgatccagattatccagacggcctggctatttttgatccg
caacataatacggctgccattctaggaatgccatactttggtgagttgaagaaatcgact
ttgaccttagcttggtcgatcgcccatcgtcacggcttcgttgcttgtcacggtggcttg
aaggccttccacttcaaggacaagcaagaccaagtcttcgccatgttcgggttatcaggt
tccggtaagtcaacactaacccacgctaaacacggctataaatacgatatcaccgttctc
cacgacgacgcctttgtcatcaatcgcaaggatggtagttccgtggccctcgagccctct
tactttgacaaaaccaacgactatccgatgacgtccgatgagaccaagtattttatgacg
atccaaaacgtcggcgtcaccttagacgatcagggtcgcaaggtccttgtcactgaagat
ctgcgcaacggtaacggccggacgatcaagtcacggtacgcttcgactaaccgggttgat
aaggaagccgctcccatcaatgcaatcttctggattatgaaagatgatagcttaccaccc
gtgattaaagtagatgatcccgtattagcagcgacattcggcgccactttagcgaccaaa
cggagctcggccgaaaatattattggtaatgtcgaccgtaacgccctagtgatcgaacca
tttgcaaacccatttagggtctatccactatcagaagattaccatgatttcaaggcactc
ttcgaagaacgccatttagattgttatctattgaatactggcttctttggcgataagaag
attcctaaggaaattaccttgggtgcgctggaagccattgtcaatgatacgaccgagtgg
gagtcattcgcaggcttggagcacatgcaaaacctaaagttagctgatttcccagttgat
tatgccaatgcagactaccgtaacttggtcgccactcgtttaggaattcgggctaacttc
attgatcaatatcaacacaacaatcatgaccagcttccccatgagattactgatattcta
gtccacctacaagatcaattaaaacaaccaattacaaaatag

DBGET integrated database retrieval system