KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_1588Help
Entry
LP6_1588          CDS       T02689                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00330  Arginine and proline metabolism
lpm00332  Carbapenem biosynthesis
lpm01100  Metabolic pathways
lpm01130  Biosynthesis of antibiotics
lpm01230  Biosynthesis of amino acids
Module
lpm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LP6_1588 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LP6_1588 (proB)
Enzymes [BR:lpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LP6_1588 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGN14496
Position
complement(1782199..1783269)
Genome map
AA seq 356 aa AA seqDB search
MKIIIKVGTQSILSVDGSPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSL
GKTYGDTVGEKQLLASIGQPELMNLYSSLFKNENILVSQLLLTKQDFHTRQHYLNIARLL
TELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPN
DPESKLINTIDPNSGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTVIANVNVESIVP
KILNREAVGTIILASKRKSSIKRWIAFSHRTSLPSIVINDNLITLLRNGNRVMSILPIGI
EDFRGECKKGDLIDILNSNNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDQLHIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattataaaagtcggaacacaaagtattttatcggtcgacggaagtccaatc
tattccgtactcaataatcttgtaaatcaaattatttatttaaagaacctggggcatcag
gtcattttagtaagctctggggctgtgggctctggtcgaaaaatagctaagaactctctg
ggaaaaacatatggcgatacagtgggagagaagcaactcttggcttcaataggccaaccc
gaactgatgaatctctattctagcttgtttaaaaatgaaaacattttagtatctcagtta
ttacttaccaaacaagacttccatactagacagcattatttaaatattgcccgtttatta
acagaattgctaaagcatcaaaatattatccctattgttaatgaaaatgattcggtagcc
attgaagaattaatgtttaccgataatgatgaattagcaggacttattgcagctcaaatt
aatgctgattatctaatactcttaaccaatgtcgatggtgtgtttacatctcatcccaat
gatcctgaatcaaaactcattaatacaattgaccccaattcaggttggcccaatgtctct
gctgtaaaatcaaaattaggccgaggtggtatggtatccaaactggatactgccagaaaa
atggctggtttaggtatcaatacagtgatcgcaaatgtaaatgtagaatccattgttcca
aaaattctaaatagggaagcagttggaaccataattcttgctagtaaaagaaaatccagt
ataaagagatggattgcttttagtcatagaacttccttaccatctatagtaattaatgat
aatttaattaccttattacgaaatggtaatcgtgtaatgagcattttaccaatagggata
gaagattttcgtggagaatgcaaaaaaggggatttaattgatatccttaattccaacaat
gaaaagataggagttggaatcgccaggtatgatttcttaagattaaaggactatcttaga
cttcaaaataagcctgcatttatacattacgatcaattgcatattctatag

DBGET integrated database retrieval system