KEGG   Legionella pneumophila subsp. pneumophila Thunder Bay: LP6_1803Help
Entry
LP6_1803          CDS       T02689                                 

Gene name
atoB
Definition
(GenBank) acyl CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lpm  Legionella pneumophila subsp. pneumophila Thunder Bay
Pathway
lpm00071  Fatty acid degradation
lpm00072  Synthesis and degradation of ketone bodies
lpm00280  Valine, leucine and isoleucine degradation
lpm00310  Lysine degradation
lpm00362  Benzoate degradation
lpm00380  Tryptophan metabolism
lpm00620  Pyruvate metabolism
lpm00630  Glyoxylate and dicarboxylate metabolism
lpm00640  Propanoate metabolism
lpm00650  Butanoate metabolism
lpm00900  Terpenoid backbone biosynthesis
lpm01100  Metabolic pathways
lpm01110  Biosynthesis of secondary metabolites
lpm01120  Microbial metabolism in diverse environments
lpm01130  Biosynthesis of antibiotics
lpm01200  Carbon metabolism
lpm01212  Fatty acid metabolism
lpm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LP6_1803 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    LP6_1803 (atoB)
   00640 Propanoate metabolism
    LP6_1803 (atoB)
   00650 Butanoate metabolism
    LP6_1803 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LP6_1803 (atoB)
   00072 Synthesis and degradation of ketone bodies
    LP6_1803 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LP6_1803 (atoB)
   00310 Lysine degradation
    LP6_1803 (atoB)
   00380 Tryptophan metabolism
    LP6_1803 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LP6_1803 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LP6_1803 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LP6_1803 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpm04147]
    LP6_1803 (atoB)
Enzymes [BR:lpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LP6_1803 (atoB)
Exosome [BR:lpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LP6_1803 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGN14711
Position
2049296..2050480
Genome map
AA seq 394 aa AA seqDB search
MEHNDVVIVAAKRTPMGAMLGNLSALSSPELGAVAHMAALSQSGIAPAEIDEVISGCVLQ
AGIGQAPARQAAIKAGIPNSTGATTINKMCGSGMKAVMLAHDLIKAGTANVILASGMESM
SNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYDKGQLMGCFAETTAKHFNFSREQQDE
YALRSMTKALKAIENGAFREEIAPVTLTTRKGDITVDVDEGPETAKLAKIPQLKPAFQAD
GTVTAANSSSISDGAASLILMSASNAEKRGIKPLAKIIAHASHSQAPQWFTTAPVDAIRK
VMNKASWKQDDVDLFEINEAFAVVAMAAITQLELNPEQVNIHGGACALGHPIGASGARIL
VTLMHALKHQGKKRGIASLCIGGGEATAMAIELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaacataatgatgtcgtgatagtcgcagcaaaaagaacaccaatgggagctatgcta
ggcaatttatctgcactttcctccccagagttaggggcagtagcgcatatggcagcgttg
tctcaatcaggtattgctccggcagaaatcgatgaagtgatcagtggttgtgtattacaa
gctggtattggtcaagctcctgccagacaggcagcaataaaagcaggcatacctaattcg
acaggagccacgaccattaataaaatgtgtggttcgggcatgaaggctgtgatgcttgcg
catgatttaattaaggcaggtacagctaatgtaattttggctagcggtatggaaagtatg
agcaatgccccctatttattatccaaagcacgagcaggatatagactgggtcatggtgaa
ctgaaagatcatatgttccttgatggattagaagatgcctatgataaaggacaattaatg
gggtgtttcgctgaaacaactgcaaaacactttaatttcagcagagaacaacaagacgaa
tatgccttacgctcaatgaccaaagcgctaaaagcaatagagaatggtgcctttcgagaa
gaaatcgctcctgtcaccttaactacccgcaaaggagatatcacggttgacgtcgatgaa
gggcctgagacagccaaacttgccaaaatacctcagttaaaaccagcctttcaagcagat
ggtacagtcacagcagccaattcaagttctatttcagatggcgcggccagtttaatttta
atgagtgcctcaaacgcagaaaaacgtggcattaagcccttggcaaaaatcatagcacac
gccagccattcccaagccccacaatggttcacaaccgctcctgttgatgcaatccgtaag
gtaatgaacaaagcgtcatggaaacaagatgatgtggatctttttgagattaatgaagcg
tttgcagtagtagcgatggcagcaattactcagcttgaattgaatccggaacaagtcaat
atacatggcggggcatgcgctttagggcatcccattggtgcttcaggagctcgcattctg
gttactttaatgcatgcgctaaaacaccagggtaaaaaacgcggaatagcttctttatgt
ataggcggtggtgaagcaacagctatggcaattgagctaatttaa

DBGET integrated database retrieval system