KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0242Help
Entry
lpg0242           CDS       T00199                                 

Gene name
serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00260  Glycine, serine and threonine metabolism
lpn00680  Methane metabolism
lpn01100  Metabolic pathways
lpn01120  Microbial metabolism in diverse environments
lpn01130  Biosynthesis of antibiotics
lpn01200  Carbon metabolism
lpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    lpg0242 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpg0242 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lpn04147]
    lpg0242 (serA)
Enzymes [BR:lpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     lpg0242 (serA)
    1.1.1.399  2-oxoglutarate reductase
     lpg0242 (serA)
Exosome [BR:lpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpg0242 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C
Motif
Other DBs
NCBI-GeneID: 19831809
NCBI-ProteinID: YP_094296
Pasteur: lpg0242
UniProt: Q5ZYW9
Position
286103..286990
Genome map
AA seq 295 aa AA seqDB search
MKIAVVEPIGIAMQEIRSELPGHTIIECDSRQWSDEQLIDFVKDADIIALTNRRLSAAVI
NSALRLQLIAVAFAGIDHIDRDAVSKRNIPVKNAAGYANTAVSELVFGLMISLARHIPDN
NQRIREQGITNTGIELKNKVLGIVGYGAIGAEVARLAKAFQMTTIIYDRKSQVTLDDLFS
QSDFVTLHVPLTNETKGMVNLRLLSQMKKSAYLINCARGPIVVNSDLKKALEQDMIAGAA
LDVFDVEPPLPANYSLWEVPNLIATPHIGFNTREALVAKGQLTIRNIKEFLSSRL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccgttgttgagcctatagggattgcgatgcaggaaattcgttctgaatta
ccaggccacacgattatcgagtgtgacagtcgtcagtggagtgatgagcaattaatagat
tttgtgaaggatgcagacatcattgcactgacgaatcgacgtttatcagctgcagtcatt
aattcagcgctgcgattacaattgattgctgttgcatttgctggaatcgaccatattgat
agggatgcggtgagtaaaagaaatattccggtaaaaaatgcagcgggttatgccaacact
gcggtatctgaactggtatttggtctcatgatttctcttgcacgtcatattcctgataac
aatcagagaataagagagcaaggcataaccaataccggtattgaactaaaaaataaagtg
ctgggcattgtcggttatggagcaatcggtgcagaagttgcgcggcttgctaaggcattt
caaatgacaactataatttatgacaggaaatctcaagtaacattagacgatttgttttcc
caatctgatttcgtcactttacatgtgccacttacaaatgaaaccaaaggcatggttaac
ttaagacttttatctcaaatgaaaaaatcagcgtatttgattaattgtgccagagggccg
attgtggttaacagtgatttaaaaaaagccttggaacaggacatgatagcaggtgccgca
ttggatgtatttgatgttgaaccaccattacctgcaaattatagcctttgggaggtacct
aatcttatcgcaacaccacacataggatttaatacaagggaggcacttgtggccaagggg
caattgactatcagaaatatcaaagagtttctttcgtcccgtctataa

DBGET integrated database retrieval system