KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0300Help
Entry
lpg0300           CDS       T00199                                 

Definition
(RefSeq) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00670  One carbon pool by folate
lpn00790  Folate biosynthesis
lpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpg0300
   00670 One carbon pool by folate
    lpg0300
Enzymes [BR:lpn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     lpg0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 19831867
NCBI-ProteinID: YP_094354
Pasteur: lpg0300
UniProt: Q5ZYR2
Position
358532..359023
Genome map
AA seq 163 aa AA seqDB search
MSLISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMGRKTYESIGKPLPGRL
NIVISQSIQSIPGVVVVDSLGRAIKETADASEVMIIGGAKIYSQAISMANRLYITRIHHQ
FTADVFFPKINELAWCCRSKEYRQHDDKNQYDMTFCVYERISI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgattagcctgatagcagccatagatgaaacaggaggattgggtattaacaac
caattactctgctatttgccagccgacttacagcactttaaatcgattaccatgggtaag
cccattatcatgggcagaaaaacttatgaatcgataggcaaacctcttccaggcagacta
aatattgtgattagtcaatcgattcagtcaatacctggtgttgttgttgtcgattctttg
ggccgggccataaaagagaccgctgacgcatcagaggtaatgatcattggaggagccaag
atttattctcaagccatatcaatggctaatcgcttatatattactcgaatacaccatcaa
tttacggctgatgtattttttccaaaaatcaatgaattggcatggtgctgccgaagcaag
gagtatcgacagcatgatgacaaaaatcaatacgatatgacgttttgcgtatatgaaaga
atatcaatttga

DBGET integrated database retrieval system