KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0443
Entry
lpg0443           CDS       T00199                                 
Symbol
icmR
Name
(GenBank) IcmR
  KO
K12220  intracellular multiplication protein IcmR
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0443 (icmR)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0443 (icmR)
SSDB
Other DBs
NCBI-ProteinID: AAU26540
Pasteur: lpg0443
UniProt: Q5ZYC9
Structure
Position
479719..480081
AA seq 120 aa
MGNNTDDSARNPFGFYTPPRVKEIGEPDVTDATLGSVYSEIISPVKDCILTVAKAVSFNP
GGKDNTDAVEVLTELNTKVERAALNQPILTTKTERMFGAAESEKSSEPPSHDERGFKLSS
NT seq 363 nt   +upstreamnt  +downstreamnt
atgggtaataatactgatgacagtgcacgaaatccatttggtttttatacgccacctcgt
gttaaagagataggtgaacctgatgtaactgatgctactctaggcagtgtctatagtgaa
attatttcaccggtaaaggattgcattttgactgttgcaaaggctgttagctttaatccc
ggagggaaagataacacggatgcagttgaggtgttaacagagctcaatacaaaagtagag
agagccgccttaaatcaaccgattttaacaacaaagacagaaagaatgtttggtgctgct
gaatctgaaaaatcgtctgagccaccaagccatgatgaacgtggtttcaaattatcatct
tga

DBGET integrated database retrieval system