KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0444
Entry
lpg0444           CDS       T00199                                 
Symbol
icmQ
Name
(GenBank) IcmQ
  KO
K12219  intracellular multiplication protein IcmQ
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0444 (icmQ)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0444 (icmQ)
SSDB
Motif
Pfam: Dot_icm_IcmQ Thymopoietin
Other DBs
NCBI-ProteinID: AAU26541
Pasteur: lpg0444
UniProt: Q5ZYC8
Position
480148..480747
AA seq 199 aa
MVPISIEVMKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDRFLKRIGA
ASQAKLKAESHLANRIALRSGQQEIYVSLYSSDGSNLQSWEKIVGSLPRQMISRPIYADE
EDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDKSISLENISR
FVHVSGVYRYSNGRLIKNA
NT seq 600 nt   +upstreamnt  +downstreamnt
ttggttcccataagtattgaagttatgaaagatcaactctcggatgaacaaaaagaaacc
attctaaaggccttaaacgatgctattgaaaaaggtccatgggataaatccaatttctta
agggtaattggtaaaaagttaattgcaattcgagatcgttttttaaaacggataggtgcc
gctagtcaggccaagttaaaagcagagtctcatcttgcaaatcgaattgccttaaggagt
ggtcagcaggaaatatatgtttcattatattcctcagatggaagcaatcttcagtcctgg
gagaaaatagtggggagtttgccccgacaaatgatttcacgacctatttacgcagatgaa
gaagacataaaagcgatattaaaaacaaaagaaaataaacaaaatgaagcgtatgtggca
atttacatcagtcaatcagatatcttgcatttatccgctgataaggctccggtagataaa
ttaggtaaaccgttattaacgcttaaagataaatccatcagtctggaaaacatcagccgc
tttgttcatgtgagtggcgtatatcgatactccaatggccgtctaattaaaaatgcatag

DBGET integrated database retrieval system