KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0447
Entry
lpg0447           CDS       T00199                                 
Symbol
lphA
Name
(GenBank) LphA (DotK)
  KO
K12216  intracellular multiplication protein IcmN
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0447 (lphA)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0447 (lphA)
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: AAU26544
Pasteur: lpg0447
UniProt: Q5ZYC5
Position
484816..485385
AA seq 189 aa
MRSLRTNYIYVLFKTTGLLFLLLLSACNRSGYIPENEVPKLPCRVDGACDATIIKMMTDL
NKKGIKVASVGQNYLISIPASALFADQSPRLNWASYSLLNEIAAFLKQFRKIAITVTSYS
SKYVSVKRERALTLARSRVVSEYLWSQGVDSRIIFTQGLGSDKPITSYTLGGDRSPNARV
EITFRRAVA
NT seq 570 nt   +upstreamnt  +downstreamnt
gtgagatcacttcgtactaactacatctatgtattgtttaaaacaactggattattattc
ttattgttgctgagtgcttgtaatcgttctggttatatccctgagaatgaagtgcccaaa
ttaccatgccgtgttgatggtgcatgcgatgcaacaataataaaaatgatgactgattta
aataaaaaagggattaaagttgcatcagtaggccaaaattatttaattagtattcctgct
agcgctctgtttgctgatcaatctcctcggttaaattgggcttcctatagccttttaaat
gagatcgcggcgtttcttaaacaatttcgtaaaattgctataacggtaaccagttacagt
agtaaatatgtgtcggtaaaaagagaacgagcattgacattggcgagatcaagagtagta
agtgaatacctatggtctcagggggttgatagcagaatcatctttacacaaggcttaggt
agtgataaacctataactagttatactcttggtggtgatagatcacctaatgccagggtg
gagatcacatttaggcgggctgtggcataa

DBGET integrated database retrieval system