KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0449
Entry
lpg0449           CDS       T00199                                 
Symbol
icmL
Name
(GenBank) IcmL (DotI)
  KO
K12214  intracellular multiplication protein IcmL
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0449 (icmL)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0449 (icmL)
SSDB
Motif
Pfam: T4BSS_DotI_IcmL
Other DBs
NCBI-ProteinID: AAU26546
Pasteur: lpg0449
UniProt: Q5ZYC3
Position
485697..486335
AA seq 212 aa
MAEDALTVVALRNKFYKDSQRKVILALLIAIVVNVVLASLVVYMITHPPAPKYFATSING
RITPLFPLDEPNQSDSAVLQWANQAAIAAFTYNFVNYRDELQASSGFFTAEGWDQFLGAL
EQSNNLDAVKAKKLVVSAVATRAPIILQKGVLNGRYSWRVQMPILVTYQSASEFTQQNNV
VTMLITRVSTLNSPRGIGISQFVVGPASGGVS
NT seq 639 nt   +upstreamnt  +downstreamnt
atggctgaagatgccttaactgtagttgcattaagaaataagttttataaagacagtcaa
cgcaaagtcattttggcgttattgattgctattgtggtaaatgtggtcttggcatcgctt
gttgtctatatgattactcatccacctgctccaaagtactttgcaacaagtattaacggt
cgtattacccctttatttcctttggatgaaccaaaccaatcggactccgctgtactacaa
tgggctaatcaggcagcaattgccgcatttacctataatttcgtaaattatcgcgatgag
ctacaggcttcttccggcttttttactgcggaaggctgggaccaatttttaggtgcatta
gagcaatccaataaccttgatgcggttaaagcgaaaaaattagttgtgtcagcagtagca
acccgagccccaatcattttgcaaaaaggtgtgctcaatggtaggtattcctggagggta
caaatgccaatattagtcacctatcaaagtgccagtgaatttacacaacaaaataacgta
gtaacaatgttaataactagagtttcaacgttgaattcgcctagagggataggtatttca
caatttgttgttggacctgccagcggtggggtatcctag

DBGET integrated database retrieval system