KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0450
Entry
lpg0450           CDS       T00199                                 
Symbol
icmK
Name
(GenBank) IcmK (DotH)
  KO
K12213  intracellular multiplication protein IcmK
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0450 (icmK)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0450 (icmK)
SSDB
Motif
Pfam: T4BSS_DotH_IcmK
Other DBs
NCBI-ProteinID: AAU26547
Pasteur: lpg0450
UniProt: Q5ZYC2
Position
486335..487420
AA seq 361 aa
MMKKYDQLCKYCLVIGLTFSMSCSIYAADQSDDAQQALQQLRMLQQKLSQNPSPDAQSGA
GDGGDNAASDSTQQPNQSGQANAPAANQTATAGGDGQIISQDDAEVIDKKAFKDMTRNLY
PLNPEQVVKLKQIYETSEYAKAATPGTPPKPTATSQFVNLSPGSTPPVIRLSQGFVSSLV
FLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYNYGNLAVRLRGLNTPVMLT
LIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLLHVLEGVPPPGSRRLVVSGG
DARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQKSPVLLVSWHGKVMQLKVEG
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
gtgatgaagaaatatgatcaattatgtaaatattgtttggtgataggcttgacattcagt
atgtcatgcagtatctatgcggctgatcaatcagatgatgctcagcaagcgttgcagcaa
ctgcgaatgctacaacaaaaattatcacaaaacccttcccctgatgcacagtcaggagcc
ggtgatggcggtgataatgcagcttctgattcaacacaacaacctaatcaatccggtcag
gccaatgctccggctgcaaatcaaacagcaactgcgggcggtgatgggcagataattagt
caagatgatgccgaagttattgataagaaagcatttaaggatatgacacgcaacttatat
cccttaaatcctgagcaagtagtcaaattaaaacaaatctatgaaacttctgagtatgcc
aaagctgcaacgccaggcactccacctaagcctacagcgacatcacaatttgttaatttg
tctccaggatcaacaccaccagtaataagattatcacaaggttttgtgtcttctttagta
ttcctggactcaacaggagctccttggcctattgctgcatatgatttgggcgacccctct
tcatttaatattcaatgggataaaaccagtaatactttaatgattcaagctacgaagcta
tataactatggcaatctagcagtaaggttaagaggattaaatactcctgtaatgcttacc
cttattcccgggcagaaagccgtggattatcgagtggatttgcgagttcaaggttatggc
cctaacgctaaaagtatgccaaccgaagaaggcattcctccatcagccaatgatttgctt
cttcatgtgttagaaggagttcctccacctggaagtaggcgtctggtggttagtggagga
gatgctcgagcttggttatctaatgaaaaaatgtatgttagaacgaatctcactatattg
tcgccgggctggttagccagcatgactagcgcagatggaacgcatgcttacgaaatgcaa
aagtctccggttttattagtgtcttggcatggaaaagtcatgcaactcaaggtagaaggg
ttataa

DBGET integrated database retrieval system