KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0454
Entry
lpg0454           CDS       T00199                                 
Symbol
icmD
Name
(GenBank) IcmD (DotP)
  KO
K12208  intracellular multiplication protein IcmD
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0454 (icmD)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0454 (icmD)
SSDB
Motif
Pfam: FtsX YrhK
Other DBs
NCBI-ProteinID: AAU26551
Pasteur: lpg0454
UniProt: Q5ZYB8
Position
492130..492411
AA seq 93 aa
MASQITGSFTSLTKLITAGSYLAGLGFSIGAIMKFKQHKDNPTQIPIGTPIALIFIAAAL
LFLPSILGVAGVTMFGGSGGKTAGPTGTIYKTN
NT seq 282 nt   +upstreamnt  +downstreamnt
atggcatcacaaattacgggttcatttacaagtcttactaaattgattacagcgggctct
tacttggctggattgggtttttctattggtgctattatgaaatttaagcagcacaaggat
aaccctactcaaattccaattggaacaccaatagctttgatatttatcgctgcggcatta
ttattccttccttctattttaggagtggccggagtaactatgttcggtggtagtggcggt
aaaactgctggacctactggaacaatatataagactaattaa

DBGET integrated database retrieval system