KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0456
Entry
lpg0456           CDS       T00199                                 
Symbol
icmB
Name
(GenBank) IcmB (DotO)
  KO
K12206  intracellular multiplication protein IcmB [EC:7.2.4.8]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0456 (icmB)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0456 (icmB)
SSDB
Motif
Pfam: GT-D T4_Rnl2_C
Other DBs
NCBI-ProteinID: AAU26553
Pasteur: lpg0456
UniProt: Q5ZYB6
Position
493271..496300
AA seq 1009 aa
MANWSESFFEGVDTFFAWLSTSLKQTTESYIDLETADSPTVLVNHDGSLLSVLKIEGITG
LAGPEEFERLVEGLANSFQAAMGRPGHALQVYFSHDKQNIVKMIKDIYDPAEATASRLEL
NLRDLFEERVNYLSQYCAEERVYFVLYTRPFNLASDQLKAANKAKMKMIKDTKAPPFKNT
QTIFAAVPEIRDTHDAYVRAILNDLDALNVIAKLLEVHDAVHAIRMTGDPDYTADDWRAT
LPGDKIPVRELNNFEGDPSDLLWPPLSRQVLPRDAEIIDLRTVRVGDKIYASTYIDLFPK
DVRPFISLFSRILPSHVPWKISFLLESEGLSTIKLKGLLAAILSFSSAQNRLISDSVNLL
KYIQLNTDEAIVRLRVVATTWAPEGNIPLLRRRSSELVKAIEGWGSTDVSEICGDPFAGF
VSSMLATTLNSSAVASVAPLSDVISMLPITRPASPWKTGALLFRTPDGKPWPFQPGSTEQ
TTWIDLVYARPGSGKSVLSNALNLALCLSGGLMRLPRIAIIDIGPSSSGLISLLKEALPA
SKRHLVAYHRLRMTPDYSINPFDTQLGCRYPTALERSFLVNFMTLLTTPLGAAKPYDGMA
DLAGMVVDELYKSMADEFNPTPYAPGIEEFIDGILEEIGFVRDAKSTWWEVTDALYSAGF
VHEAMLAQRYAMPLLADAASICRTPSIEDLYEKITAPTGESLINAFSRMISSAVREYPIL
SRVTSFDIGDARVVSLDLDEVAKSGGDAADRQTAVMYMLARYVLARHYYLTEESLNNVPE
QYKEYHKQRVLEIREDHKRIVYDEFHRTAKSSAVREQVIIDMREGRKWKVQISLLSQAVD
DFDPVMIDFATAIYVMDAGPSQAVEKTSQIFGLSETAKIALRTRVHGPRQGGATFLAQFA
TKTGINVQLLTLTLGPVELWAFSTTAEDATVRNLLYRHLGPSEARRLLAALFPNGTVTKE
LEARLASMKQKVGLIEDDEREGMINQLVNDILDAYSKDPNVKSLPAKVG
NT seq 3030 nt   +upstreamnt  +downstreamnt
atggcaaattggtcagaatcgttttttgaaggcgtcgatactttctttgcctggttaagt
acttccttgaagcaaactacagagtcttatatagatttggaaacggcggatagccctacc
gtattagttaatcatgatggatcattactgtcggtattaaaaattgaagggattactgga
ttggcaggccctgaagagtttgaacgactcgttgaaggtttagccaactcatttcaagct
gctatgggtagacctggtcatgcgctacaagtttattttagccatgataagcaaaacata
gtaaaaatgatcaaggatatttatgaccctgcggaagcaacagcaagtcgtcttgaactt
aatttaagagatttatttgaggagcgggtcaattatttatcacaatattgtgcagaggag
cgtgtttattttgttttgtatacaagaccatttaacttggcgagcgatcagttaaaagct
gcgaacaaagcaaaaatgaagatgatcaaggatacaaaagctcctccatttaaaaacaca
caaacgatttttgcggctgttccggaaataagagatacacatgatgcttatgtgcgtgca
attctaaatgatttggatgcccttaatgtgatagctaagttgcttgaggtgcacgatgca
gtacatgccattcgcatgacaggtgatcctgattatactgcagatgattggcgcgcaact
ttacctggagataaaatacctgttcgcgagctgaataattttgagggggatccttctgat
ttattatggccgccgttgtccaggcaggttttgccaagagatgcagagattattgattta
cgcactgtccgagtgggcgataaaatttatgcttcaacctatattgatttgtttccaaag
gatgtaagaccatttattagtttattttctcgtattcttccttcacatgtgccctggaaa
atttcttttttgctagaaagcgaaggattaagcacaattaaattgaaggggctcttggca
gcgatattgagctttagctctgcacagaatcgtttaattagtgattcggttaatctgctg
aaatatatacaactcaatactgatgaggcgattgtaagactacgcgtcgttgcaacaacc
tgggctcctgaaggcaatattcccttgttgcggcggagaagttctgagttagtaaaggct
attgaaggttggggttctactgatgtatcagagatttgtggggatccgtttgcaggcttt
gtgtcaagtatgctagctactactttgaacagctcagcagtagcatcagtagctcctttg
tcagacgttatctcaatgctgcctattacaagaccagcatctccctggaaaacaggagcc
ttgctttttagaacaccagatggtaaaccgtggccgtttcaaccaggctcaactgaacaa
actacttggattgatctggtttacgctcgtcctggttctggtaaatctgtgttgtcaaat
gcactgaatttagctctttgtctttcaggtggtttaatgcgtttgccgcgcatagcaatt
attgatataggcccctcaagtagcggtttgatttcattgttaaaagaggctctccctgca
tctaagcgtcatttggttgcttatcatagattaaggatgaccccagattattcgattaat
ccctttgatacccaattgggatgtcgttatccaactgctttggaacgatcattcttagtc
aacttcatgaccttgctaactacgccattaggtgctgcaaagccatatgacggtatggca
gatttggcgggtatggtggtagatgaattatataaaagcatggctgatgaattcaatccg
acaccctatgctccaggaatagaggaatttatcgatggcatcctggaggaaataggcttt
gtccgagatgccaaatcaacctggtgggaagtgacggacgcgctctattcagcaggtttt
gttcatgaggcgatgttagcgcaaagatatgcaatgccgttattagcggatgctgcttct
atctgtagaacaccatcaattgaggatttatatgaaaagattacggcgccaactggtgaa
tcactaattaatgctttttcaagaatgatttcatcagctgttcgcgaatatcctatttta
tcacgggtcactagttttgatattggtgacgcaagagtagtgtctcttgatttggatgaa
gtagcgaaaagtggtggtgatgcggcagatagacaaacagcggttatgtatatgctagcc
agatatgtattggcaaggcactattatttaacagaagaaagtttgaataatgtaccggaa
caatataaagagtatcacaaacagagagtattagagattcgagaagatcataagcgtatt
gtttatgatgaattccatcgcacggcaaaatcgtctgctgttcgtgagcaagttattatt
gatatgcgtgaaggccgaaaatggaaagtgcaaatttccttattatcacaagcagtagat
gactttgatccggtaatgattgattttgctaccgctatttatgttatggatgcaggacca
tctcaagctgtcgagaagaccagtcaaatttttggactttctgaaacagccaagattgcg
ttacgtactcgagttcatggtcctagacaaggtggcgctactttccttgctcagtttgct
actaaaacaggtatcaacgtacaattattaaccttaacattgggcccggtcgaattatgg
gcatttagtactactgcagaagatgccacagtacgaaatcttttgtataggcatctggga
ccaagtgaagctcgacggcttttagctgcactgttcccaaatggtacagtgactaaagaa
ttggaggctcgattagcaagcatgaagcaaaaagttgggttaattgaagacgatgagaga
gagggaatgattaaccaattggtgaatgatattcttgatgcttattcaaaagatcccaac
gtgaaaagcttgcctgcaaaagtaggttga

DBGET integrated database retrieval system