KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0457
Entry
lpg0457           CDS       T00199                                 
Symbol
tphA
Name
(GenBank) TphA (ProP)
  KO
K12226  proline/betaine transport protein TphA
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lpn02044]
    lpg0457 (tphA)
Secretion system [BR:lpn02044]
 Type IV secretion system
  Icm/Dot secretion system protein
   lpg0457 (tphA)
SSDB
Motif
Pfam: Sugar_tr MFS_1 MFS_1_like
Other DBs
NCBI-ProteinID: AAU26554
Pasteur: lpg0457
UniProt: Q5ZYB5
Position
complement(496446..497702)
AA seq 418 aa
MKQNTKHSIIAGLYGNALEWYDFLLYASFAPVFAEIFFPSKIHFVSLIATFSLFAIGFIM
RPIGGLLLGHYADHVGRRKALILSMSVMTISTALIAVLPDFNSWGIIAPLLFSVLRLIQG
LAVGGELPGSTTYLIEHMFQQSRGLAGSLVLSSAFLGIFIGALTASIFSTLFTGDALLNW
GWRYAYLLGGILGILGIYLRIKSFESPTFLKDKHTAELPAKVVFTRFKQQLFLSVIITSI
LAMSNYVLIAYVTTFLVKSEYFLLKDALLINLIALALLTVLIPLMGFLSDVVGRKPIFLI
GLFALCLLIFPFFWLLLSGSWWKALCSELLLAIALAPINATVPTIIAEMFPTSVRASGIS
ISYNIGQALFGGTMPLVAFSLIELSSNKMAPAWYLFLWTLIVIPITISIRESYQKELT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgaaacaaaataccaaacacagcattattgctggattatacggaaatgctttggagtgg
tatgatttcttgctctatgccagttttgctcctgtctttgctgaaatttttttcccttca
aaaatccattttgtttctcttatagcaacatttagcttatttgctataggattcattatg
cgtccaattggtgggcttttgctcgggcactatgctgatcatgtaggacggcggaaagca
ttaatactatctatgtcagtaatgaccatttctaccgcattaattgcagtattacctgat
tttaattcatggggaattatcgccccacttttattttctgttttacggctcattcagggg
cttgcagtgggaggcgaactgcccggctcgaccacctatttgattgagcatatgtttcaa
caaagccgggggctcgctggcagcctcgtgttaagtagcgcttttttaggtatttttatt
ggagcgcttaccgcctcaatattcagcacattatttacaggtgatgctctattaaattgg
gggtggaggtatgcgtatctgttaggaggtattttaggaattttgggcatttatttgcgt
attaaaagctttgaatcacccacatttctaaaggataagcatactgctgaacttcctgca
aaagtggtattcacgcgatttaaacagcaactgtttttatctgtgataattactagcatt
cttgccatgtctaattatgtacttatcgcctatgtcacaacttttttagtcaaatcagag
tattttctcttgaaagatgcgttattaatcaatttaattgcccttgctcttttgacagtt
ttaataccgctgatgggatttctttctgatgttgtgggacgtaagcctattttcttaatc
ggtttatttgctctttgcctactaatcttcccatttttttggctcttattaagtggtagt
tggtggaaagcattatgcagcgaattattactagcgatagctttagccccaatcaatgcg
acagtacccactattattgcagaaatgtttccaaccagtgtacgggcgagtgggatttcc
atatcctataacattggccaggctttatttggcggtaccatgcctttggttgcgtttagc
ctgattgaattaagcagcaataaaatggctccggcttggtaccttttcctatggaccctt
atcgtgataccaataactatttccattcgtgaaagctatcaaaaagagcttacttaa

DBGET integrated database retrieval system