KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0466Help
Entry
lpg0466           CDS       T00199                                 

Definition
(RefSeq) pyruvate carboxylase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00020  Citrate cycle (TCA cycle)
lpn00620  Pyruvate metabolism
lpn01100  Metabolic pathways
lpn01120  Microbial metabolism in diverse environments
lpn01200  Carbon metabolism
lpn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpg0466
   00620 Pyruvate metabolism
    lpg0466
Enzymes [BR:lpn01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     lpg0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 GCV_H PTS_EIIA_1 RnfC_N NQRA
Motif
Other DBs
NCBI-GeneID: 19832032
NCBI-ProteinID: YP_094510
Pasteur: lpg0466
UniProt: Q5ZYA6
Position
506656..508464
Genome map
AA seq 602 aa AA seqDB search
MSQEELMSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEVWGGATFDAC
LRFLKEDPWSRLRQLRQMLPNTQLSMLLRGQNLLGYRNYADDVVRAFVKLAVNNGVDVFR
VFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELGKKLAEMGCDSIAIK
DMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAGCNHIDTAISSFS
GGASHPPTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFESEAQNIDPRVQLY
QVPGGMISNLYNQLREQNALDKMDAVHKEIPRVRKDLGYPPLVTPTSQVVGTQAVINVLT
GERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRPGDLLPNELDQLQNEI
SDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAPDNSVMSEFDIILHGES
YHVKVAGYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERSSVNNKIGPGDITVAIPG
SIIAIHVSVGDEVKAGQAVLVIEAMKMETEIKAPANGVVAEILCQKGDKVTPGQVLIRVE
VS
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
ttgagccaggaagagcttatgtctaaaacgtttataacagatgtcaccttgcgtgatgcc
catcaatgcttaatcgctacaagaatgcgtactgaagatatgttgccaatctgtaataaa
atggatgatgtaggattttgggctatggaagtctggggaggcgctacttttgatgcctgt
ttgcgatttttaaaggaagatccctggtcaagattgcgtcaacttcgccaaatgttaccg
aatactcaactctctatgctgttaagaggtcaaaatttgttaggctataggaattatgca
gatgatgtagtccgagcgtttgttaaattggccgtgaataatggagtggatgtatttcgt
gtgtttgatgctttaaatgacgcgcgaaaccttaaagtagccatagacgcgattaaatca
cataaaaaacatgcccagggagcaatttgttacacaaccagcccggttcatactttggac
aattttttggagctagggaaaaaattggctgaaatgggatgtgatagtatcgccataaaa
gatatggcaggtttgctaaccccaacggtgactgtcgaattgtatgccggtttaaaacaa
gcgactggcttacctgtacatttgcatagtcattctacttccggtttggcaagtatatgc
cattatgaggccgttttagcgggttgtaatcacattgatacagcgatttcatctttttct
ggcggtgcatctcatccacctacggaagcattggttgccgcattgactgacactccgtat
gacacggaattggatttaaatattttattggaaatagacgattattttaaagctgtccgc
aagaagtattctcaatttgaaagtgaggcacagaatattgaccctcgtgttcaattgtat
caagtgccaggtggcatgatctcaaatctgtataatcagttaagggagcagaatgcatta
gacaagatggatgctgttcacaaggaaatcccccgcgttcgtaaggacttgggttatccg
cctttggttacgccaacatctcaagtcgttggaactcaggcagttattaatgttctaacg
ggagaacggtataaaacaataaccaatgaagtgaaactctactgtcagggaaaatatggc
actcctcctggcaaaattagttctgctttacggaaaaaagcgatcggacgaacagaagtg
attgaagtcaggcctggcgatttgttacctaatgaattagatcaattgcaaaatgaaata
agtgatttggcactaagtgatgaggatgttcttctttatgcgatgtttcccgaaattggg
cgccaattcttagagcagcgtaaaaataatcaattaattcctgagccattattgactcaa
tcaagtgcaccagataattccgttatgtctgagtttgatattattcttcatggtgagagt
tatcatgtaaaagtagctggttatggaatgattgagcatggtcaacaatcctgttttttg
tgggttgatggtgttcctgaagaagttgttgtgcaacattctgaacttcatgacaaaata
gagcgttcatctgttaataacaagataggacctggagatattactgtagctatccccggt
tctattattgcaattcatgtttctgttggtgatgaagtcaaggccgggcaggctgtactg
gttattgaggcaatgaaaatggagacagaaataaaagcacctgcaaatggggtggttgca
gaaatattatgtcaaaagggagacaaagtgactccagggcaagtattaatcagagtggag
gtgagttaa

DBGET integrated database retrieval system