KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0529Help
Entry
lpg0529           CDS       T00199                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00020  Citrate cycle (TCA cycle)
lpn00190  Oxidative phosphorylation
lpn00650  Butanoate metabolism
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01120  Microbial metabolism in diverse environments
lpn01130  Biosynthesis of antibiotics
lpn01200  Carbon metabolism
Module
lpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lpn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpg0529 (sdhD)
   00650 Butanoate metabolism
    lpg0529 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    lpg0529 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 19832095
NCBI-ProteinID: YP_094572
Pasteur: lpg0529
UniProt: Q5ZY44
Position
569526..569873
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLSFSQWHLLFTNKAFQIA
TTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLTQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagtttaacaggaaatgggttaaaggattggttaattcaacga
gttaccgctgtctattttgcagcctatttaatttttttgtttggatttatattggcaaat
cctgatttaagtttttctcaatggcatcttttgtttactaacaaggcatttcaaattgca
acaacaattggattgatggctttgacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgttatacgtttatcagtgcagttattagttgttttgtgg
ctccttactcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system