KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0533Help
Entry
lpg0533           CDS       T00199                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00020  Citrate cycle (TCA cycle)
lpn00310  Lysine degradation
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01120  Microbial metabolism in diverse environments
lpn01130  Biosynthesis of antibiotics
lpn01200  Carbon metabolism
Module
lpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpg0533 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    lpg0533 (sucB)
Enzymes [BR:lpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     lpg0533 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_3
Motif
Other DBs
NCBI-GeneID: 19832099
NCBI-ProteinID: YP_094576
Pasteur: lpg0533
UniProt: Q5ZY40
Position
575283..576512
Genome map
AA seq 409 aa AA seqDB search
MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVVLEVPSPVDGVLSDIL
FNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISESESVSTKEDKSTSPVVR
RMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKANQTAEVQKEPSMRALSFGGREE
KRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRSQYKDSFEKKHGVKLGFMS
FFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTERGLVVPVIRDADQLSMAEIE
LAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATPIINPPQTGILGMHKIEERPI
VEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELLEDPSRLLLNV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgaagtcaaagtacctgttctacccgagtcagtagctgatgcaacagtggct
gcgtggcataagaaagtgggtgataaagtatctcgcgatgagaacctagtggatctggaa
acagataaagttgtgcttgaagttccatcacctgtggatggggtattgtctgacattctg
tttaataccggagatacggttggttcaggagacttactggcaaaaatttctcaaagtgtt
tctgtagaatctcaaaaaactgagaaagaagagaaacctgtcaaaaaagaagaaataaaa
atttccgaaagtgaatcagttagcacaaaagaagataaatcaaccagtccggtagtaaga
cggatgatggctgaaaatgatttgaaagccgggcagattcaaggtaccggtaaagatggc
aggataaccaaagaagacgttttatcttatatagaatctaatagagaaaaagcaaaccaa
accgctgaagttcaaaaagaaccttctatgagagcactttcctttggcggcagggaagaa
aaacgtgtccctatgacgagactaagagccaagattgcggaacgtttactacaagcacaa
cacaacgctgccatgttaaccacttttaacgaagtgaatttgaaggcagttatggacatg
cgttctcagtataaggatagttttgaaaaaaaacatggtgtaaaacttggatttatgtct
tttttcacaaaagcagtagtagagtcgctgaaacgattcccggccgtgaatgcttccatt
gatgggcaagatattgtttatcatggtttttatgatataggaattgctgtttctactgaa
agaggtttagttgttccggtaattagagacgctgatcaattaagcatggcagaaattgaa
ttagccattaatgatgcggcatcaaaagccagaaccggtaagctgtctatggaagagatg
caagggggaacatttaccataaccaacggtggagtattcggttcattattagctactccc
attatcaacccaccgcaaacaggtatcttggggatgcataaaattgaggaaagacctatt
gtagagaaagggcaaatagtaatccgtcctatgatgtatgttgctttgtcttatgatcat
cgtttaattgatggaaaagattctgtacaatttttagtaagtgttaaagagttgttggaa
gatccgtctcgacttttacttaatgtttaa

DBGET integrated database retrieval system