KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0540Help
Entry
lpg0540           CDS       T00199                                 

Definition
(RefSeq) major facilitator family transporter
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 MFS_1_like Sugar_tr
Motif
Other DBs
NCBI-GeneID: 19832106
NCBI-ProteinID: YP_094583
Pasteur: lpg0540
UniProt: Q5ZY33
Position
581844..583127
Genome map
AA seq 427 aa AA seqDB search
MGISKVEIYKRKNYLGFAWLVWGLAAAFYFSDYLARVAPGVMHRYLQMDFGINEAGFGIL
TASFYVPYILMQIPVGLTVDRLSIRWLLTIMSLVTAFGCCVFGLADGLLTASIGRMLIGF
SAAFAFICSLRLATSWFPPTMLGLLSGLTQALGMLGAAAGEAPVSFLVSNVGWRHSMLII
AFLFIALSGLLYQFVQDKPGEHRNEIRSVNRISILDSLKIILSNKQTWLNAMYAGFLFGP
TAVIGEAIGPAYLQFGRGLGAHAAAFATGLIFIGWGISGPLSGWISDKMGRRKPLMIISA
VCGVILSSLFVFIPEMSQTTAYILFFVFGLTNTGVAISYAVSTEIHDRSVVGTSIAFTNM
TSIFVGALFQPLVGRIIDMVSGPRAYNVETLLLSDFQAGLKLLPLCSLVALILAFTVKET
YCKPIRH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgggaatatctaaagtggaaatttataaacgtaaaaattacctgggttttgcgtggtta
gtttgggggttggcagctgctttttatttttctgattatttagctagagtagcgcctggt
gtaatgcaccgatatctacaaatggactttggcattaatgaggctggcttcggcatatta
actgcatcattctatgttccatatatcttaatgcaaattcctgtaggattgacagttgat
cgattaagcatacgatggttattgactattatgtcattagttactgcttttggttgctgt
gtatttggccttgcggatggtctgctgactgcatcaattggaagaatgttgattggtttc
agtgctgcttttgcattcatttgctcacttcgccttgccacttcatggttccccccaact
atgcttggattattatctggattaactcaagcgttgggaatgcttggtgctgccgcaggg
gaggcccctgtttcatttttagtgagtaatgttggctggcgccatagcatgctgattatc
gccttcttatttattgccttatcaggattattgtatcaatttgtgcaagataaacccggt
gagcatcgcaatgaaattcgttctgttaatcgaatcagtattttggatagcttaaagatc
attttatcaaataaacaaacttggcttaatgcgatgtatgctggatttttatttggcccc
accgctgtaattggagaggcaataggtccggcatatttacagttcggccgtggtttaggg
gcgcacgcagctgcatttgcaacaggattgatctttataggctggggaattagtggccca
ttatcaggttggatttctgataaaatgggacgtcgtaagccattgatgattatttccgca
gtatgtggtgtgatcttgagcagtttatttgtttttattcctgaaatgagtcaaacaacg
gcttacatactattttttgtttttggtcttacaaacactggggttgcgatttcatacgct
gtttctacagaaatacatgacaggagtgttgttggtacatctatcgcatttaccaatatg
acttcaatttttgtcggggccttattccagcctttagtaggacgtatcatagacatggtg
tctgggcccagagcctataatgttgaaacgttattattatcggatttccaagccggtcta
aaattactccccttatgttccttggtggccttaatccttgcgtttactgttaaagagact
tattgcaaacccataaggcattaa

DBGET integrated database retrieval system