KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0833Help
Entry
lpg0833           CDS       T00199                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpn01100  Metabolic pathways
lpn01110  Biosynthesis of secondary metabolites
lpn01130  Biosynthesis of antibiotics
lpn01230  Biosynthesis of amino acids
Module
lpn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpg0833 (trpC)
Enzymes [BR:lpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     lpg0833 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth NanE HTH_5
Motif
Other DBs
NCBI-GeneID: 19832399
NCBI-ProteinID: YP_094868
Pasteur: lpg0833
UniProt: Q5ZX99
Position
complement(913515..914291)
Genome map
AA seq 258 aa AA seqDB search
MNSILERIAKHKLEEVAVAKKNKPLHVLSKQQPGEMRDFITALKSNTSPAVIAEIKKASP
SKGLIRKDFNVAEIAKIYTQNGARCLSVLTDIEFFQGHPDYLALAKSKTTLPVLRKDFII
DSYQIYESLVLGADCILLIVALLDDVQLMDFCQLAQELKMSVLVESHTQDELERALRLPT
PLIGINNRSLHNFKTDIQLSIQLKQFVPKDKIIITESGINTREDIKLMQSHGINAFLIGE
SLMRADNIGKALQKLMTD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatcctggaacgaatagcaaaacataaactagaagaagttgcagttgcgaaa
aaaaataagcctttacatgttctgtcaaaacaacagccgggggaaatgcgtgacttcata
actgctttaaaatccaatacctcacctgcagtcatagctgagataaaaaaggcttctcca
agcaaaggtttaattcgaaaagattttaatgttgcagaaattgccaagatttatacccaa
aatggcgcaagatgcttatccgttttaacggatattgagttttttcaaggtcatcctgat
tatttggctttagcaaaatcaaaaaccactttgcccgtattgcgtaaagactttattatt
gattcttatcaaatctatgaaagccttgtcttgggtgctgattgcattttactgattgtc
gcattattagatgatgttcaattaatggatttttgccaactggctcaagaacttaaaatg
tctgttttggttgaaagccacacgcaagatgaattagaaagagcattacgcttacccacc
ccccttataggcattaataaccgcagcctacacaactttaaaacagacattcaactgagt
atccaattaaaacaatttgttcctaaagataaaattattattactgaaagcggaatcaac
acccgtgaagacataaaattaatgcaatcccatggcattaatgcctttttgattggagag
agtttaatgagggcagataacatcgggaaagcattacagaaactaatgactgactaa

DBGET integrated database retrieval system