KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0917Help
Entry
lpg0917           CDS       T00199                                 

Gene name
murE
Definition
(RefSeq) UDP-N-acetylmuramyl-tripeptide synthetase MurE
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
Pathway
lpn00300  Lysine biosynthesis
lpn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    lpg0917 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lpg0917 (murE)
Enzymes [BR:lpn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     lpg0917 (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:lpn01011]
 Precursor biosynthesis
  Amino acid ligase
   lpg0917 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Motif
Other DBs
NCBI-GeneID: 19832483
NCBI-ProteinID: YP_094951
Pasteur: lpg0917
UniProt: Q5ZX16
Position
990018..991469
Genome map
AA seq 483 aa AA seqDB search
MKLTQLLEPWIKRDIIDGTVSDIKNDSRLVKEGDLFVAYPGAASDGRLYIEKAVASGAVA
VVYEPNNLPQGITLPTGIPCIAIPQLAEKLGEIAKRFFNNPSQFLGLTGVTGTNGKTTIA
YQLAQAHDLLGQHSAYIGTIGQGKVDALKPLENTTPDALCLQRLMHQYKEGGIKQVCMEV
SSHALSQHRVDSLEFSQAIFTNLTLDHLDYHQTMQAYGAAKSRLFERAELQWAIINQDDD
FQDLMSNVLKTHVKKVTYGMHQNCDVKALQWNMDITGTEIEVKSPWGHHLLKIKALGKFN
IYNSLAVYSSLLASGYNPEKVVQVMAELKAAPGRMEIVAQSPYVLVDYAHTPDALENVLI
TLKQIKKGRLWVVFGCGGDRDKTKRPIMGKAASMYADNIVITSDNPRSEDPEIILNEIAC
GIPASAPVSKLVNREEAIAYALRKAEHNDIILIAGKGHESYQQIGNTKHVFSDQEVVRRL
MNN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaacccaattattagaaccgtggattaaaagggacattattgatggcactgtg
agtgacataaaaaatgacagccgcttggtgaaagaaggggatttatttgtcgcctatcca
ggggcagcttccgatggtcgattatatatagaaaaagccgtggcatcaggtgctgtcgct
gtggtttatgagcccaataatttacctcagggaattactttgccaacaggaattccctgt
atagccattccccaattagctgaaaaattaggggaaatagcgaaacggttttttaataac
ccatcccaatttcttggtttaactggggtaactggcacaaatggtaagacgactattgct
tatcagttggcacaggcacatgatttactcgggcagcactcggcttacatcgggactata
gggcaaggaaaggtggatgccttaaaacctttggaaaatactacgccagatgctctttgt
ttgcagaggttaatgcatcagtataaagaaggaggcattaaacaggtttgtatggaggta
tcctctcatgcgctgagccagcatagagtcgactctctcgaatttagtcaggctatcttt
accaatttaacgctcgatcatttagattatcaccagacaatgcaagcttatggggctgca
aagtcgaggttgtttgaacgagcagagttgcaatgggctattattaatcaggatgatgac
tttcaagatctcatgagcaatgtgctaaagactcatgtaaaaaaagtgacttacggtatg
catcaaaattgcgatgtgaaagcgctccaatggaatatggatatcaccggaacagaaatt
gaagtcaaatctccttgggggcaccaccttctaaagattaaagcactgggtaagtttaat
atttataatagcctggctgtttatagcagtttgcttgccagcgggtataatccagaaaaa
gtagtgcaagttatggccgaattaaaagcggctcctggccgaatggaaattgtcgctcaa
tccccatatgttcttgttgattatgctcatactcccgatgcattggaaaatgttcttatc
accttaaaacaaataaaaaaagggagattgtgggttgtatttggttgtggtggggacaga
gataaaaccaaacggcccattatgggaaaggcagccagcatgtacgctgataatattgtc
attaccagcgataatccaagaagtgaagatccggaaattattctaaatgaaattgcttgt
ggcattcctgcctctgcgcctgtctctaaactggtgaatagagaagaggcaattgcttat
gctttaagaaaggctgagcataacgatatcatattaatagcaggaaaaggacatgaatcg
tatcagcagattgggaatacaaaacatgttttttctgatcaggaagttgtaagacgtttg
atgaataattaa

DBGET integrated database retrieval system