KEGG   Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1): lpg0986Help
Entry
lpg0986           CDS       T00199                                 

Definition
(RefSeq) hypothetical protein
Organism
lpn  Legionella pneumophila subsp. pneumophila Philadelphia 1 (serogroup 1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-GeneID: 19832552
NCBI-ProteinID: YP_095019
Pasteur: lpg0986
UniProt: Q5ZWU9
Position
complement(1078587..1080140)
Genome map
AA seq 517 aa AA seqDB search
MIVFNPLSLYTTYLGWQQYEVLFNALWQTGLLYLGFLAIGYRFLKNVLNPAGAFYAVEHA
LNNFLYELAITFLICSLFVYPCVPLETKALQFKPLCGLKNPTTAVIGDSGTTYDEAFADL
LTNQVKIPIGFAIIQNFISSFTYSLMKVTGCTDSLQSIQGDLVSTYLPQSVRKQALDFHR
QCFIEARTQFNSEKHEASELDPMLKRYGGEDDLNWMGSKILQKMYYSKLHARQPVPGFTF
HQAPNRNLEKAANRGDIPPERLPEDGYPSCQQWWNKIKTDLVEVSNQASVFNKHLNYYAM
LDRVRQYKVKHPKAWKADISAEDFIAKMLLQESKDMQTSSVQNLMDNNNGKVASAITHSL
VNVGQWTKSWTSTPLKREAIMQTLPVMQAFFMFFLIILTPMVLSLSCYSTRALGSLCALF
VMAIFLQYLWHLVGFLERSVLDPLGENDAISAMKNMAVMFYFVAPVLLLRLSSHFGGDAG
AGLMDLVNGADRQSESMAQSGMQVAKTGVKIISKGIQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgattgtctttaatcctttatctctctataccacctatctaggctggcaacagtatgag
gttctattcaacgccctgtggcaaacagggctgttgtatcttggctttttggccattggt
tatcgctttcttaaaaatgtgctcaatccagctggcgcgttctatgcggttgaacatgct
ttaaataattttctttatgaattggcaataactttcctgatatgcagcttatttgtctat
ccttgtgtaccgttggaaaccaaagccctacaatttaaacccttatgcggactgaaaaac
ccaacgactgcggtcattggcgacagcggcacaacttatgatgaagcctttgcagatcta
ctgactaaccaggtcaaaattcctataggctttgccatcatccagaattttatatcgagc
tttacctacagccttatgaaggtgacgggttgcaccgatagtttgcaatccattcaagga
gatttggtatcaacctatctcccccagagcgttcgcaagcaggcattggattttcataga
caatgttttattgaagccagaactcaattcaatagtgaaaagcatgaagccagtgaatta
gaccctatgctcaaacgctatggcggtgaagatgacttaaactggatgggttctaaaatc
ctgcaaaaaatgtattacagcaaacttcatgctcgccaacccgtgccaggatttaccttt
catcaagcccctaatcgcaatcttgaaaaggcagctaatcgtggcgatatcccacccgaa
cgattgccagaagatggttatcccagctgtcagcaatggtggaacaaaatcaaaactgac
ctggttgaagtctctaatcaggccagtgtttttaataaacacttaaactactacgccatg
cttgatagggttcgccaatataaagtgaaacacccaaaagcctggaaagcagacatcagc
gcagaagattttattgcgaaaatgctcttgcaagaaagcaaagacatgcagaccagttct
gtgcaaaacctcatggataataacaatggaaaagtcgcatctgccattacccatagcctg
gtcaatgtcggacaatggacaaaatcatggacatccaccccattaaaaagagaagcaatc
atgcaaacattgcccgtcatgcaggcgtttttcatgttctttttaatcattctcactcca
atggttttgtctttaagctgctacagcaccagagcattaggcagtttatgcgccttattt
gtcatggctatttttcttcagtacctctggcatttagtcggatttcttgaacgttcagtg
cttgatccattaggtgaaaacgatgcgatttctgccatgaagaatatggctgtgatgttt
tactttgttgcacctgttttattgttgagattatcaagccattttggcggtgacgctggg
gcgggtcttatggatttggtcaatggtgcagataggcaaagcgaaagcatggcgcaatcc
ggtatgcaggtagccaagacaggagtaaaaattatttcaaaaggaattcaatga

DBGET integrated database retrieval system